KEGG   Pantholops hodgsonii (chiru): 102335385Help
Entry
102335385         CDS       T02909                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04371  Apelin signaling pathway
phd05034  Alcoholism
phd05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102335385 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    102335385 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    102335385 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phd03036]
    102335385 (HDAC4)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102335385 (HDAC4)
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102335385 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro COQ7
Motif
Other DBs
NCBI-GeneID: 102335385
NCBI-ProteinID: XP_005971489
LinkDB All DBs
Position
Un
AA seq 1559 aa AA seqDB search
MGPDHRGQVAREPGDEQPRGGPLHQNGALAPGGYWSVLDFSPKAGHLSLRNSLTILEKLH
DRRLSGLDAQSFWVQPQVDMAFTVAAPCPQGDPCSTPATPGCASAVRSVVKGHLKSQQQE
LLARKHQQELLEHQRKLERHRQERELEKRHREQKLQQLKNKEKGQESAVASTEVKMKLQE
FVLNKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKD
DFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPG
SAPSSPNNSSGNVSTENGITPAVPSIPAETNLAHRLVAREGSVGPLPLYTSPSLPNITLG
LPATGPSTGAAGQQEAERLALPALQQRVSLFPGTHLAPYLGTAPLERDAGAAPGSLLQHV
VLLEQPPAQTPLVTDRYLAGLGALPLHAQPLVGAERVAPNSQQRVPSGESPAESAQQRHR
APEAQVPGPWTLALCLPIAAASAKGLLPRGLRPSIQHLMIPKPSEPARQPESHPEETEEE
LREHQALLEEPFLDRLPAQKEAHALAGVQVKQEPIESDDEETEPPREAGPGQRLPTEQEL
LFRQVCSIWSEAMTFGPKKTLVTSLTGPEKQPGLDTRSQAPGASANDSKEGRAGEATVPA
AMWTRQCLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGRCECIRGRKATL
EELQTVHSETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSS
GAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQR
LSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGF
NVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNL
SAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQR
PNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAMASLSVAVKA
PEKRLFCGSHVAGPWLGAAGLNFEACGHGEPEALGALAGGQQVSTLYPFAGNPVMPRDSW
CPSALRAFQLRLRAPEPHQQAAVPGPPPGRLGLATPPSTEASFLLCTLTSFQGVVEAAPR
AYRNLVLGGERAQVPLDPVEGSSSGTVLVQWKVQPSAQTQDHQGPTEGSPSPGGQQDCKG
VNFGCPEYSLYVFSDGRAWGFQQLPTSQGNFEPLSPSLGAPQEGRCPSSTSYGAPGHWTR
AWAGVPRPKQNGAEKGSPSCTCGVWGTEGRDRWYRRGPRECRVLCPGGGQGLCGMKGEPE
SLSPNPAYTLGVTVAQLIRHREPPPLSRGKADGAEKPGCSADQGWGHPGSLESLACWPRS
SATIWAITASVWTSLVKQNLDCVQGRRHPFPPDSCGRETEFGQWSVSRTPPGVEMLCPED
SWRPGLCFTLRGPSNAHHPDHRPVQEQGSPSPFHRACRVPLGATGQALRTAFLQAGQQP
NT seq 4680 nt NT seq  +upstreamnt  +downstreamnt
atgggccctgaccaccgtggccaagtagctcgtgagcctggagatgagcagcctagagga
ggccccctccatcagaatggtgctctggcccccgggggttactggtctgtcctggacttc
tccccaaaagcgggccacctgagccttagaaactccttgaccatcttggaaaagctccat
gaccgccgcctgtcggggcttgatgcacagagcttctgggtccagccccaggtggacatg
gccttcaccgtggcagccccatgcccccagggtgacccctgctctaccccggccacacca
ggctgtgctagcgctgtgcgttctgtggtgaagggccacctgaaatcccaacagcaggag
ctgctggccaggaagcaccagcaggagctgctcgagcaccagcggaagctggagcggcac
cggcaggagcgggagctggagaagcggcaccgggagcagaagctgcagcagctgaagaac
aaggagaagggccaagagagcgccgtggccagcacggaagtgaagatgaagctgcaggag
tttgtcctcaataaaaagaaggccctggctcatcggaacctgaaccactgcatgtccagc
gaccctcgctactggtacgggaagacgcagcacagctcgctggaccagagctccccgccc
cagagcggggcgtcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagac
gactttcccctcagaaagacagcttctgaacccaacctgaaattacgctccaggctaaag
cagaaagtggctgagagacggagcagccccctgctacgcaggaaagatgggccagtggtc
acggctctgaaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgccccaggc
tccgcgcccagctcgcccaacaacagctccgggaacgtgagcacggagaacgggatcacg
cccgccgtccccagcatcccagccgagaccaacctggcgcacagactcgtggcgcgagag
ggctcggtgggcccgctacccctctacacctcaccatccctgcccaacatcacgctgggg
ctgcccgccaccggcccctccacgggggcagccggccagcaggaggccgagagactggcc
ctccccgccctgcagcagcgcgtctccctcttccccggcacccacctcgccccctacctg
ggcacggcgcccctggagcgtgacgcgggggcagcccctggctccctgctgcagcacgtg
gtgctcctggagcagccgcctgcacagacgcccctcgtcacagaccgctatcttgcaggc
ctgggcgcgctgccgctgcacgcgcagcccctggtaggggctgagcgcgtggcaccaaac
tcccagcagagagtccccagcggagagtccccagcggagagtgcccagcagaggcacagg
gcccccgaagcacaggttccaggcccctggacactggcgctctgcctgcccattgcagca
gcctcggccaaagggctcctgcccagaggtctgcgtccctccatccagcatctgatgatc
cccaaacccagcgagccagcccggcaacccgagagccaccccgaggagacggaggaggag
ttgcgggagcaccaggcgctcctggaggagcccttcctggaccggctcccggcgcagaag
gaggcccacgcgctggctggggtgcaggtgaagcaggagcccatcgagagtgacgacgag
gagacggagcccccgcgggaggcgggccccggccagcggctgcccacggagcaggagctg
ctcttcagacaggtttgcagcatctggtcagaagccatgacctttgggcccaagaagaca
ctagtgaccagcctgacaggtccagaaaagcagcctggtctggacacccggagccaggcc
cctggagccagtgctaatgacagcaaggagggcagggcaggggaagccactgtccccgct
gccatgtggactcggcagtgcctcgtgtatgacacgctgatgctgaagcaccagtgtacc
tgcgggaacaccaacagccacccggagcacgccgggcgcatccagagcatctggtcacgg
ctgcaggagaccggcctgcgaggcagatgtgagtgcatccgtggacgcaaggccacactg
gaggagctgcagacggtgcactcggagacgcacgccctgctctacggcacgaaccccctc
aacaggcagaaactggacagtaagaaacttctaggctcattaacgtccgtgttcgtcagg
ctgccctgcggtggtgtcggggtggacagtgataccatatggaacgaggtgcactcgtcg
ggggctgcccgcctggccgtgggctgtgtggtggagctggtcttcaaggtggccacgggg
gagctgaagaacggctttgctgtggtccgccctccaggacaccacgcagaggagagcacg
cccatggggttctgctacttcaactccgtggccatcgctgccaagcttctccagcaaagg
ctgagcgtgagcaagaccctcgtggtagactgggatgtgcaccacgggaacgggacccag
caggccttctacagcgacccccgcgtgctctacatctccctgcaccgctacgacgatggc
aacttcttcccaggcagcggcgcgcccgacgaggtgggcacaggcgctggcgtgggcttc
aacgtcaacatggctttcaccggcggcctggacccccccatgggagacgcagagtacctg
gcggccttcaggactgtggtcatgccgatcgccagcgagttcgccccagatgtggtgctg
gtgtcctcgggcttcgacgctgtggagggccaccccacgcccctcggaggctacaacctc
tccgccaaatgttttgggtacctgacgaagcagctaatgggcctggccggtggccgggtt
gtcctggcgctggaggggggccacgatctcacagccatctgcgacgcctcggaagcctgc
gtctctgctctgctggggaatgagcttgatcctctcccagaaaaggtcttacagcagaga
cccaacgccaacgccgtgcggtcgatggagaaggtcattgaaatccacagccagtactgg
cgctccctgcagaggctcgcctctaccgctggctactccctggtcgaggcccagaagtgt
gagaacgaggaagccgagactgtcactgccatggcctcactgtctgtggccgtgaaggcc
cctgagaagaggctcttctgcggcagccacgtggcagggccctggctgggagcagcaggc
ctgaactttgaagcctgtggccatggagagcctgaggccttgggggcactggccgggggt
cagcaagtgagcactttatacccctttgcaggaaaccctgtgatgccgcgcgactcgtgg
tgtccctctgcccttcgggccttccagctgcgcctcagggcgcccgagccccaccagcag
gcggccgtccccgggccgccccccggccgcctgggactagccacccctccgagtacagag
gcctcgtttctgctctgcaccctgacctcctttcagggggtggttgaagctgctccacgt
gcttacaggaacctggttctcggaggggagagggcacaggtgcccctggaccctgtggaa
gggtccagcagtggaacagtgctggtccagtggaaggtccagccctcagcccagacccaa
gatcatcaggggcccacggagggcagcccctcacccgggggccagcaggactgcaaggga
gtcaatttcggttgtcccgagtactctctttacgtgttctctgatgggagggcatggggc
ttccagcagctccccacatctcagggcaattttgagcctctgtccccatccttgggggcc
ccccaggaagggcgatgtccatcctccacctcctatggggctcctgggcactggaccagg
gcctgggccggtgtccccagacccaagcagaatggagccgaaaaggggtcacccagctgc
acctgtggggtctgggggactgagggccgggacaggtggtaccgccggggccccagggag
tgtagggtgctgtgccctggaggagggcagggcctgtgtggcatgaaaggggaaccagag
agcctgagccccaaccctgcttacactttgggcgtgacagtggcgcagctcatcagacac
cgagagccacccccactatcccggggaaaggctgatggagcggagaagcccggctgctct
gccgatcagggctgggggcacccaggcagcctggagagcctggcctgctggccccgcagc
tcagccaccatctgggccatcactgcctccgtgtggacgagcctggtgaaacagaacctt
gattgtgttcagggccgcaggcacccatttccaccagacagctgcggccgtgagactgag
tttggccagtggtcggtgagcagaacacctccgggtgtggaaatgctctgcccagaggac
tcatggaggcctggcctgtgcttcacactccgggggccatccaacgcccatcaccctgac
catcggcctgtccaggagcaggggtcaccgtccccgtttcacagggcttgccgtgtcccg
ttgggggccacaggccaggccctaaggacagccttcctacaggccggccagcaaccctga

DBGET integrated database retrieval system