KEGG   Pantholops hodgsonii (chiru): 102336314Help
Entry
102336314         CDS       T02909                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:phd00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    102336314 (TGM2)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102336314 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 102336314
NCBI-ProteinID: XP_005983107
LinkDB All DBs
Position
Un
AA seq 687 aa AA seqDB search
MAEDLVLERCDLELEVNGGDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AMTGPDPSEETGTKALFRLSDAMEEGAWAAVVVDQQDSTLSLQFSTPANAPIGHYRLSLE
ASTGYQGSSFMLAQFTLLFNSWCPADAVYLNSDEERQEYILTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLTLLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKKDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSLHKSINHSL
VVGLKISTKSVGRDDREDITHNYKYPEGSPEEREAFTRANHLNKLVDKEETGVAMRIRVG
EGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTEALSGCTFTVEGAGLIEGQKTVDAPDPVEAGEEVKVRVDMLPLYVG
RHKLVVNFESDRLKAVKGFRNIIVGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggtcctggagagatgtgacctggagctggaggtcaatggcggtgac
caccacacagctgacctgtgcagggagaggctggtggtgcggcggggccagcccttctgg
ctgactctgcactttgagggccgaaactatgaggccagcgtggacagcctcaccttctgt
gccatgactggcccagaccccagtgaggagaccgggaccaaggccctcttcaggctgtcc
gatgctatggaggagggggcctgggcagcggtggtagtagaccagcaagacagcaccctc
tcgctgcagttcagcaccccggccaatgcccctattggccattaccgcctcagcttggag
gcctccaccggctaccagggctccagtttcatgctggctcagttcaccctgctcttcaac
agctggtgtccagcggatgctgtgtacctgaactcagatgaggagcggcaagaatacatc
cttacccagcaaggcttcatctaccagggctcagccaagttcatcaagagcataccttgg
aattttgggcagtttgaagacgggatcctagacatctgcctgacgctcctggacgtcaac
cccaagttcctgaagaatgccggccgagactgctcccgccgcagtagtccggtctatgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctggggcgc
tgggacaacaactacggggatggcatcagccccatgttctggattggcagcgtggacatc
ctgcggcgttggaagaaagatggctgccagcgcgtcaagtatggccagtgctgggtgttc
gcagctgtggcctgcaccgtgctgcggtgccttggcatccccacccgcgttgtgaccaac
tataactcagcccacgaccagaacagcaacctgctcatcgagtacttccgcaacgagttc
ggggagatccagagtgacaagagcgagatgatctggaactttcactgctgggtggagtcg
tggatgaccaggccagacctgcagccggggtatgaagggtggcaggcccttgatcccacg
ccccaggagaagagcgaagggacttactgctgtggcccagttcctgttcgtgccatcaag
gagggcgacctgagcaccaaatacgacgccccttttgtctttgccgaagtcaacgctgac
gtggtggactggatccggcaggacgatgggtctctgcacaaatccatcaaccactccctg
gtggtggggctgaagatcagcacgaagagtgtgggcagagatgatcgggaggacatcacc
cacaactacaagtacccggaggggtccccagaggagagggaagccttcacgagagccaac
cacctgaacaaactggttgataaagaggagacaggggtggccatgcggatccgtgtgggc
gagggcatgaacaggggctgcgacttcgacgtctttgcccacatcaccaacagcaccccc
gaggagcacactggccgcctcctgctctgtgcccgcaccgtcagctacaacgggatcctg
ggacctgagtgcggcaccaaggatctgctcagcctttccctggagccctactccgagaag
agcatcccccttcgaatcctctacgaaaagtactgtgattgcctgaccgaatcgaacctt
atcaaggtgcggggccttctcattgagccggctgccaatagctacctgctggccgagagg
gacatctacctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggtgtctctgcggaacccgctcaccgaggcactgtcaggctgc
accttcactgtggagggggcgggcctgatcgaggggcagaagacggtggacgcccctgac
cccgtggaggcaggggaggaagtcaaagtgagggtggacatgctgcccctgtacgtgggc
cgccacaagctggtggtgaacttcgagagcgacaggctgaaggccgtgaagggcttcagg
aacatcatcgttggccctgcctaa

DBGET integrated database retrieval system