KEGG   Pantholops hodgsonii (chiru): 102336661Help
Entry
102336661         CDS       T02909                                 

Gene name
KMT2D
Definition
(RefSeq) lysine methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00310  Lysine degradation
phd04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102336661 (KMT2D)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    102336661 (KMT2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phd03000]
    102336661 (KMT2D)
   03036 Chromosome and associated proteins [BR:phd03036]
    102336661 (KMT2D)
Enzymes [BR:phd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102336661 (KMT2D)
Transcription factors [BR:phd03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    102336661 (KMT2D)
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102336661 (KMT2D)
   HMT complexes
    MLL-HCF complex
     102336661 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 102336661
NCBI-ProteinID: XP_005981045
LinkDB All DBs
Position
Un
AA seq 5517 aa AA seqDB search
MDSPKPPGEDKDSEPAADGPAASEESGATEPDLPKPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGNPGPNEGALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEHSEGATHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAPGGQPVSS
LAEQHPPVCSRFSPPEPGATLTDEPNSLYIACQGQPKGGYVTSMQPKEPGPLQCEAKPLG
REGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEDSPTSPPPEASRLSPPPEDSPLSPPP
EESPLSPPPESPPFSCPEDSPSHPPLDTPLPPPPEASPLSPPLEESPLSPPPEELPTSPP
PEASRLSPPPEESPMSPPPEESPMSPPPEASCLFPPFEESPLSPPPEESPLSPPPEASRL
SPPPEDSPMSPPPEDLPMSPPPEVSRLSPPPEESPLSPPPEESPTSPPPEASRLSPPPED
SPTSPPPEDPPASPPPEDLLVSLPLEESPLLPLPEELRLCPRPEEPHLSPQPEKPRLSPA
PQEPRLSPAPQELCLSPASEEPRLSPAPQQPHLSPAPEEPRLSPEPHLSLASEELRLSPQ
PEEPRLSPRPEEPRLSPRPEESRLSPRPEELRLSPQPEEPCLSPRPEEPHLSPQPEEPIE
EPGLCPASEELPLFLPPREPPLSPVLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQL
MPPDPLPPPLSPIITTVAPPALSPLGELEYPFDAKGDSDPESPLAAPILETPISPPPEAN
CTDPEPVPPMILPPSPGSPMGPASPILMEPLPPHCSPLLQHSLPPSNSPPSQCSPALPLS
VPSPLSPMDKAVEVSEEAEPQKMETEKAPEPECPALEPSPTSPLPSPLGNLSCPAPSPAP
ALDDFCGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKCSPVLLDSEELAPVTPMEVYG
PECKQAGQGSPCEEQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSP
DPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGGSKAEGDKGR
RRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVVADIDSSPSK
EEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN
SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWK
CKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWM
HAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPEPQYFRFEGV
WLTETGMAVLRNLTMSPLHKRRQRRGRPGLPGEAGLEGAEPSEVLGPDDKKDGDLDTDEL
LKAEGSVEHMECEIKLEGPVSPDGEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRV
KKGPAAQAEVLSGDGQPDEVLPADLPAEGSVDQSLADGDEKKKQQRRGRKKNKLEDMFPA
YLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDVA
DEESRGPESKADTPGPEDGGIKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKD
LQQLFKDVLGSEREQHLGCGTPGLDGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQS
PFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDE
ELGQLSTISPVLYANINFPSLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAA
HRINKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPT
TPAGLSTSADGFLKPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLASAYALEPRFP
TAPPTYPPYPSPTGAPAPPPTLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCP
SLDNLAVPESPGGGGGKAAEPLLSPLPFGESRKALEVKKEELGGSSPSYGPPNLGFVDSP
SSGPHLGGLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHSDIFR
PGPYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPL
SAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPSEVAFKAGPLAHTPLG
AGGFPAALPSGPAGELHAKVPSVQPPNFARSPGTSAFVGTPSPMRFTFPQVVGEPSLKPP
VPQPGLPPPHGINSHFGPGPTMGKPQSTNYAVATGNFRPSGSPLGPSSGPAGEGYGPSPL
RPPSVLPQPAPDGPLPCLPHGAAPRAGITSPVEKREDPGAGTGSSLAAPELSGTQDPGMS
GLSQTELEKQRQRQRLRELLIRQQMQRNTLRQEKETAAAAGAVGPPGSWGAESSSPAFEQ
LGRGQTPFAGTQDKSSLVGLPPGKLGGPILGPGAFPSDDRLSRPPPPATPSXXXFHSRQL
VGGSQAFYQRAPYPGSLPLQQQQQQLWQQQQQATAAASMRLTMSARFPSTPGPELGRQTL
GSPLAGISNRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGPPFPGQGPPQRPRFYPVT
EDSHRLAPEGLRGLAVSGLPPQKPSAPPAPELNNSLHPTPHTKGPNLPTGLELVSRPPSS
TELGRPPPLALEAGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLEN
LETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVE
PGPLGPEERPPPAADAPEPRLASGLPEVKPKVEEGGRHPSPCQFTITTPKAEPAPVTSSL
GLGVKPGQSVTGSRDTRMGTGPFSSSGHTAEKVPFGTTGGPPAHLLTPSPLSGPGGSSLL
EKFELESGALTLPGGHASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQ
PVQQQQPQQHSLLSTPGPAQAVSLPHEGSSPNLTGPQQQLSLGLGGSRQPGLAQPLMPTQ
PPAHALQQRLAPSMAMVSNQGHMLSGQHGGQAGLVPQQNPQPVLAQKPMGTMPPSMCMKP
QQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQ
QVSLLAQRLSGGPGSDLQNHVAAGSGQERGAGDSSQPRPNPPTFAQGVINEADQRQYEEW
LFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSK
IQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQ
LLPGHGLQPPQGPPGGQAAGLRLTPGGMALPGQPGGPFLNTTLAQQQQQQHSGGAGALPG
PSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQQHLLGQVAIQQQQQ
QGPGVQANQALGPKPQGLLPPSSHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQQPHPG
ALGPQGPHRQVLLTQPRVLSSPQMAQQGQGLMGHRLVTSQQQQQHQQQGSMTGLSHLQQG
LMPHNGQPKLGAQPMAALQQQQLQQQQQQQQLQQHQQLQQQQQQQQLQQQQQQLQQQQQQ
QQQLQQQQQQQQQLQQQQQLQQQQQQQLQQQQQQLQQQQQQQQQLQQQQQLQQQQQQQQL
QQQQQMGLLSQSRALLSPQQQQQQQQMTLGPGMPAKPLQHFSSPGALGPTLILTGKEQSI
VETALPSEASEGPSTHQGGPLPMGTVPESVATEPGEVKPSLSGDSQLLLVQPQAQPQPNS
LQLQPPLRLPGQQQPPVNLLHTAGAGSHGQPGSGSSEASSVPHLLAQSSVSLGEQPGSVT
QNLLSSQQPLGLERPMQNNIGPQPAKPGSVPQSGQSLPGAGVMPTVGQLRAQLQGVLAKN
PQLRHLSPQQQQQLHALLMQRQLQQSQAARQAPPYQEPGTQPSPLQGLLGRQPQLGGFPG
SQTGPLQELGAGLRPQGPPRLPAPQGALSTGPVLGPVHPTPPPSSPQEPKRPSSELPSPS
SQLPSEAQLPITQPGTPKPQGPPLELPPGRVSPAAAQLADTFFGKGLGPWDPPDHLVEAQ
KLEQSSLVPGHLDQVNGQVVPEPPHLNIKQEPREEPCALGSQAVKREANGEPVGAPGTSN
HLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRAEINGHIDSKLAGLEQKLQGTPS
TKEDTAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEP
TITANFSLFAPFGSGCPISGQCQLRGAFGSGVLPTGPDYYSQLLTKNNLSNPPTPPSSLP
PTPPPSVQQKMVNGVTPSEELGEHPKDATSARDTEGVLRDASEVKSLDLLAALPTPPHNQ
TEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQDDRALSPVIPIIPRA
SIPVFPESKPYGVLDLEATRKLPAPTWEKGKGSEVSVMLTVSAAAAKNLNGMMVAVAELL
SMKIPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKSLGGKSPEAGPDWLKQFDAVLPGY
TLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPAS
PXRPPIPSPLPLASSPESTRPKPRARPPEEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGG
VRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHL
NCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIR
AKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRV
GGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPE
FVIKVMEQGLEDMVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHA
VLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSM
SKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKH
TMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPN
CVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 16554 nt NT seq  +upstreamnt  +downstreamnt
atggacagcccgaagccgcctggtgaggataaagattcggaaccagcagctgatggacct
gcagcctccgaggagtcaggtgccactgagccagaccttcccaaaccacatgttggggag
gtctctgtgcccagttctgggggtccccggcttcaggaacctccccaggactgcagcggg
ggtccggtgcggcgttgtgctctctgtaactgcggagagcccagtctacatgggcagcgg
gagttacggcgctttgagttgccatttgactggccccggtgtcccgtggtgtcccctggg
gggaacccagggcccaatgagggagcgctgcccagcgaggacctatcacagatcggtttc
cctgagggcctgacacctgcccacctgggagaacctggagggtcctgctgggctcaccat
tggtgcgctgcgtggtcggcaggcgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccagacttggtgcc
tccatcccttgccgctcgcctggatgttcccgtctttaccacttcccctgcgcaactgcc
agcggttccttcttatccatgaaaacactgcagctgctatgcccagagcacagtgagggg
gccacacatctggaggaggctcgctgtgcagtatgtgaggggccaggggaattatgtgac
ctgttcttctgtaccagctgtgggcatcactatcacggggcctgtctggacactgctctc
actgcccgcaagcgtgctggctggcagtgccctgaatgcaaagtgtgccaagcttgcagg
aaacctgggaatgactctaagatgttggtctgtgagacgtgtgacaaaggataccatacc
ttctgcctgaaaccaccaatggaggaactgcctgctcactcttggaagtgcaaggcatgc
cgggtgtgccgggcctgtggggcaggctcagctgagctgaatcccaactctgagtggttt
gagaactactcgctctgtcaccgctgtcacaaagccccaggaggacagcctgtcagttct
cttgctgagcagcaccctccggtctgtagcagattctcacccccagagcctggcgctacc
ctcactgatgagcccaatagtctgtacattgcgtgccaggggcagccaaagggtggatac
gtgacctctatgcaacccaaggaaccggggcccctgcaatgtgaagccaaaccactaggg
agagaaggggcccaacttgagccccagttggaggcccccctaaatgaggagatgccactg
ctgcccccacctgaggagtcgcccttgtccccaccacctgaggactcacccacgtccccg
ccgcctgaggcatcgcgcctgtccccaccgcctgaggactcacccctctctccaccgcct
gaggagtctcctctgtctcccccacctgagtcaccacccttctcttgcccagaggactcc
ccctcacatcccccacttgatacacccttacccccaccacctgaagcatcacccctgtcc
ccaccactggaggagtctcctctgtcccctccccctgaagaattacctacttctccacca
ccggaagcatctcgcctgtctccaccaccggaagagtcacccatgtctccgccacctgaa
gagtcacccatgtctccgccacctgaggcctcttgtctgttcccaccatttgaggagtcg
cccctgtcccctccacctgaggaatctcctctctccccgccacctgaggcgtcacgccta
tccccaccacctgaggactcacccatgtccccaccacctgaagacttgcctatgtccccc
ccgcctgaggtgtcacgcctgtcccccccgcctgaggagtctcccttgtcaccgccacct
gaggagtctcccacatcccctccacctgaggcttcacgcctgtctcctccacctgaggac
tcccctacgtctccgccacctgaagacccgcctgcttctccgcctccggaggacttgctc
gtgtccctgccgctggaggagtcaccgctgttgccactgcctgaggaactgcgactctgc
ccccggcccgaggagccacacctgtcccctcaacctgagaaaccgcgcctgtctcctgca
ccccaggagccgcgtctgtcccctgcaccccaggagctgtgcctgtcccctgcatctgag
gagccacgcctgtcccccgcaccccagcagccgcacctgtcccctgcacctgaggagcca
cgcctgtcccctgagccacatctgtcccttgcatccgaggaactacgcctgtctccccag
cctgaggaaccgcgcctgtccccccggcctgaggaaccgcgcctgtcccctcggcctgag
gaatcgcgcctgtcccctcggcctgaggaactgcgcctgtcccctcagcctgaggagcca
tgcctgtccccccggcctgaggaaccgcacctgtcccctcaacctgaggagcccattgag
gagccaggcctgtgccctgcatctgaggaattgcccttattcctcccacccagggagcca
cccttatcccctgtgcttggagagccggccctgtctgagcctggggaaccacctctgtcc
cctctgcctgaggagctgccgttgtccccatctggggagccatctttgtcacctcagctg
atgccaccagatcctcttcctcctccactttcacccatcatcacaactgtggccccacca
gccctgtctccgttgggagagttagagtacccctttgatgccaaaggggacagtgaccct
gagtcgccactggctgcccccatcttggagacacctatcagccctccaccggaagctaac
tgcactgaccctgagcctgtaccccctatgatcctccccccatccccaggctcccccatg
ggacctgcctctcccatcctgatggagccccttccccctcattgttccccactcctccag
cattccctgcctccctcaaactcacctccttcccagtgctctcctgccttgccactgtcg
gttccttccccgctgagtcccatggacaaggcagtggaggtctcagaagaggctgagcca
cagaagatggagactgagaaagccccagaacctgagtgcccagccttggaacccagccct
actagtcctcttccgtctcctctggggaacctttcctgccctgcacccagccctgcccca
gccctggatgacttctgtggcctgggggaagatacagcccctctggatgggactgacact
cctggttcacaaccagaggctggacagacccctggcagtttggctagtgaacttaagtgt
tcccctgtgctcctggactctgaggagctggcccctgtgacccctatggaggtctatggc
ccagaatgcaagcaggcagggcagggctcaccctgtgaagagcaagaggagccacgtgca
ccagtggccccaaccccacctactctcatcaaatccgacatcgttaatgagatctccaat
ctgagccagggcgatgccagtgccagttttcctggctcagagcccctgctgggctctcca
gatcctgaggggggtggctccctgtccatggagttgggggtatctacagatgttagtcca
gcccgagatgagggctccctgcggctctgtaccgactcgctgccagagactgatgactcg
ctattgtgtgatgctgggacagctattggaggaagcaaagctgagggggacaaggggagg
cggcgcagctccccagctcgttcccgcatcaaacagggtcgcagcagtagtttcccaggg
agacgccggccacgtggaggagcacatggaggacgtgggagaggacgggcccggctaaaa
tcaactacttcttccattgagactctggtagttgctgatatcgatagctctcccagcaag
gaggaagaagacgatgatgatgataccatgcaaaatactgtggttctcttctccaacaca
gacaaatttgtgctaatgcaggacatgtgtgtggtgtgtggcagctttggccggggggca
gagggccacctccttgcctgttcccagtgctcccagtgctatcacccgtactgtgtcaac
agcaagatcaccaaggtgatgctgctgaagggctggcgttgtgtggagtgcatcgtgtgc
gaggtgtgtggccaggcctcagacccctcccgcctcctgctctgtgatgactgtgacatt
agctaccacacgtactgcctggaccccccactgctcaccgtgcccaagggtggctggaag
tgcaagtggtgtgtgtcttgtatgcagtgtggggccgcctcccctggcttccactgtgaa
tggcagaatagttacacacactgcgggccctgtgccagcctggtgacctgccctatctgt
catgccccctacgtggaggaggacctgctgatccagtgtcgccactgtgaacggtggatg
catgccggctgtgagagcctcttcacagaggatgatgtggagcaggcagctgatgagggc
tttgactgtgtctcctgccagccttacgtggtcaagcctgctgcgcctgtcgcacctcca
gagttggtacctatgaaggtgaaagagcctgagccccagtactttcgcttcgagggtgtg
tggctgacagaaacaggcatggcggtgctgcgtaacctgaccatgtcgcctctgcacaag
cggcgtcagaggcgtggacggcctggcctcccaggtgaggcggggctggagggggccgag
ccttcagaggtcctgggccctgatgacaagaaggatggtgacctggacacggacgagctg
ctcaaggctgaaggtagtgtggagcacatggagtgcgaaattaaactggagggtcctgtc
agccctgatggagagcctggcaaagaggagaccgaggagagcaaaaaacgcaaacgcaaa
ccctatcggcctggcatcggtggtttcatggtgcgacagcggaaatcccacacacgtgtg
aaaaaagggcctgcagcacaggcggaggtgttgagtggggatgggcagcccgacgaggtg
ttgcctgctgacctgcctgccgagggctctgtggaccagagcttagccgatggggatgag
aagaagaagcagcagcggcgagggcgcaagaagaacaaactggaggacatgttccctgct
tacctgcaggaagccttctttggaaaggagctgctagacctgagccggaaggccctgttt
gcagttggcgtgggccggccaagctttggattgggaacccccaaagccaagggcgatgga
ggctcagagaggaaggagctcccaacctcacagaaaggagatgatggtccggatgttgca
gatgaagaatcccgtggccccgagagcaaggctgatacaccaggacctgaggatggtggc
ataaaggcatccccagtgcccagtgaccccgagaagccaggcaccccgggtgaagggatg
cttagctctgacttagacaggattcccacagaagaactgcctaagatggaatccaaggac
ctgcagcagcttttcaaggacgttctgggttccgaacgagagcagcatctgggttgcgga
acccctggcctggacggcagccggacaccgctgcagaggccctttcttcaaggtggactc
cctttgggcaatctcccctccagcagcccaatggactcttacccgggcctctgccagtcc
ccattcctggattctagggagcgcgggggcttctttagcccggaacccggtgagccagac
agcccctggacaggctcggggggcaccacgccctccacccccaccacccccaccacggag
ggtgagggcgacgggctctcctataatcagcggagtcttcagcgctgggagaaggacgag
gagttgggccagctctccaccatctcacctgtgctgtacgccaatattaacttccccagt
ctcaagcaggattacccagactggtcaagccgctgcaaacaaatcatgaagctgtggaga
aaagttccagctgctgataaagccccctacctgcaaaaggccaaagataaccgggcagct
caccgcatcaacaaggtgcagaagcaggctgagagccagatcaacaagcagaccaaggtg
ggcgacatggcccgcaagactgaccgaccggccctacatctccgcattcccccccagcca
ggggccctgggcagtccacctcctgctgctgcccccaccattttcattggcagccccacc
acccccgccggcttgtctacctctgcggacgggttcctgaagccgccggcgggcacggtg
cccggccctgactcgcctggtgagctcttcctcaagctcccgccccaggtgcccgcccaa
gtgccttcgcaggacccctttggactggcctctgcctatgctctggagccccgcttcccc
acagcaccacccacctaccctccctatcctagtccgactggggcccctgcaccgccccca
acgctgggagcctcgtctcgtcctgggactggccagccaggggagttccacactacccca
cctggcaccccccgacaccagccctccacacctgaccccttcctcaaaccccgctgcccc
tccctggacaacctggctgtgcctgagagcccagggggagggggaggcaaggctgctgag
cctctgctgtcgcccctgccttttggggagtctcggaaggccctggaggtaaagaaggaa
gagcttgggggatcctctccgagctatgggcccccaaacctgggctttgttgactctccc
tcctcaggcccccacctgggtggcctggagttaaaggcacctgatgttttcaaagccccc
ctgacccctcgggcatctcaggtagagccccagagcccgggcttgggcctaaggccccag
gagccaccccctgctcaggctttggccccttctcctcccagccactcggacatctttcgc
cctggtccctaccctgacccctacgcccaacccccgctgacccctcggccgcaaccccca
ccacctgagagctgctgtgccctgcctccccgctcactgccctctgaccctttctcccga
gtgcccgccagtccccagtcccagtccagctcccagtccccattaacaccccgtcctctg
tctgctgaggctttctgcccatcccctgttacccctcgcttccagtcccctgacccttat
tcccgtccaccctcacgccctcagtcccgggatccatttgccccattgcataagcccccc
cgcccccagccctctgaagttgccttcaaggctgggcctctagcccacactccgctgggg
gctgggggtttcccagcagccctgccctcagggccagcaggtgagctccatgccaaggtc
ccaagtgtgcaaccccccaattttgcccggtcccctgggaccagtgcatttgtgggcacc
ccttctcccatgcgtttcactttccctcaggtggtcggggagccttccttaaagccccct
gtccctcagcctggtctccctccaccccatgggatcaacagccattttgggcccggccct
accatgggcaagcctcaaagcacaaactacgcagtagccacagggaacttccgcccatcg
ggcagccccctggggcccagcagcgggcccgcaggagagggctacgggccgtccccgctg
cgccccccgtcagtccttccccaacccgcacccgacgggcccctcccctgcctgccccat
ggggccgcaccacgggcgggcatcacctctccggtcgagaagcgagaagacccaggggct
ggcacgggcagctctttggcggcacctgagctttcaggtacccaggacccaggcatgtct
ggcctcagtcagacagaactagagaagcagcgacagcgccagcgactgcgggagctattg
attcggcagcagatgcaacgcaacacccttcggcaggagaaggagactgcggcagctgcc
ggagcggtgggacccccaggcagctggggtgctgagtctagtagccctgcgtttgagcag
ctgggtcgaggccagaccccctttgctgggacccaggacaagagcagccttgtggggctg
cccccaggcaagctgggtggccccatcctggggccaggggctttccccagtgatgaccga
ctctcccggccacctccaccagccaccccctcnnnnnnnnnnttccacagccggcaattg
gtggggggctcccaagccttctatcagcgagcaccgtatcctgggtccctgcccttacag
cagcagcagcagcaactgtggcagcagcagcaacaggcaacagcagcagcttccatgcga
cttaccatgtctgcgcgctttccctcaactcctgggcctgaacttggtcgccaaaccctt
ggttcccctttggctggaatttccaaccgcctgcctggccctggtgaaccagtgcctggc
ccagctggtcctgcccagttcattgaattgcggcacaatgtacagaaaggactcggacct
ggggggcctccatttcccggtcagggccctccacagagaccccgtttttaccctgtaact
gaggattcccaccgactagcccctgaagggcttcgtggcctagcagtctcaggccttcct
ccacagaaaccttcagccccaccagctcctgaactgaacaacagcctccatccaacgccc
cacaccaagggtcccaacctgcccactggcttggagctagttagccggcccccctccagc
actgagcttggccgcccccctcctctggccctggaagctggaaaactaccttgtgaggat
cctgagctggatgatgactttgatgcccacaaggccttggaggacgatgaggagcttgct
cacctgggcctgggtgtggatgtggccaagggagacgatgagctgggcactctggaaaac
ctagagaccaatgatccccacctcgatgacctgctcaatggggatgagtttgacctgctg
gcctatactgaccctgagctggacacgggggacaagaaggacatcttcaatgagcatctg
aggctggtggagtcggccaatgaaaaggctgaacgagaggctctgttgcgaggggtggag
ccaggacccttgggccccgaggagcgccctcccccggctgctgatgcgcctgagccccgt
ctggcatcagggcttcccgaggtgaagcccaaggtggaggagggtgggcgccacccttcc
ccttgccagtttaccattaccacccccaaggcagagccagcacctgtcaccagttcccta
ggcctgggggtgaagccaggtcagagtgtgacgggcagccgggacactcgaatgggcaca
ggacctttttctagcagtgggcacacagctgagaaggtcccctttgggaccacaggagga
ccaccagctcacctgctgacgcccagccccctgagtggcccgggagggtcctccctactg
gaaaagtttgagctagagagtggggccctgactttgcctggtggacatgcatctggggat
gagctggacaagatggagagctcactggtagccagtgagttacccctgctcattgaggac
ctgttggaacatgagaagaaagagctgcagaagaagcagcagctttcagcgcagctgcag
cctgtgcagcagcagcagccccagcagcattccctgctgtccaccccaggccctgcccag
gctgtgtctttgccccatgagggctcttctcccaatttgactgggcctcaacagcagctt
tccctgggacttggaggctcccgacagccaggcttggcccaaccgttgatgcccacccag
ccaccagctcatgccctccagcagcgcctggccccatccatggccatggtatccaaccaa
gggcatatgctaagtgggcagcatgggggacaggcaggcttggtgccccagcagaaccca
cagccagtgctggcacagaagcccatgggtaccatgccaccgtccatgtgcatgaaacca
cagcagctggcaatgcagcagcagttggctaacagctttttcccagatacagacctggac
aaattcgctgcagaagatatcattgatcctattgcaaaggccaagatggtggctttgaaa
ggcatcaagaaggtgatggctcagggcagcattggagtggcacctggtatgaacaggcag
caagtgtccctgctagctcagaggctctcaggggggcccggcagtgatctgcagaaccac
gtggcagctgggagtggccaggagcggggtgccggtgactcctcccagcctcgtcccaat
ccacccacttttgcccagggagtgatcaatgaggctgaccagcggcagtatgaggagtgg
ctgttccatacccagcagctcctacaaatgcagctgaaggtgctagaggagcagataggg
gtgcaccgcaagtcccggaaagccctgtgtgccaagcagcgcactgccaagaaggctggc
cgggagttccccgaggctgatgctgagaagctgaagctggttacagaacaacagagcaag
atccagaaacagctggatcaggtccggaagcagcagaaggagcacactaacttaatggca
gaatatcggaataagcagcagcagcagcaacagcagcagcagcaacagcagcagcactca
gccgtacttgcccttagcccttcccagagtccccggctactcaccaagcttcctggtcag
ctgctcccaggccatgggctgcagccacctcaaggaccccctggggggcaagctgcaggt
cttcgcctgacccccgggggcatggccctacctggacagcctggtggccccttcctcaac
accaccctggcccaacagcagcaacagcaacattctggtggagctggggccctgcctggc
ccctcagggggctttttccctggcaaccttgctcttcgaggcctgggacctgactcgagg
cttttacaggaaaggcagctgcagctccaacagcagcgcatgcagctggcccagaaactg
caacagcagcagcagcagcagcatctcctaggacaggtggcaatccagcagcaacagcag
cagggaccaggagtacaggcaaaccaggctctgggtcccaagccccagggccttctgcct
cccagcagccaccagggcctcttggtccagcagctgtccccccaaccaccccaggggccc
cagggcatgctgggccctgcccaggtggcagtattgcagcagcagcaaccacaccctgga
gctttgggcccccagggccctcacagacaggtgctcctgacccagccgcgggtgctaagt
tctccccagatggcacagcagggtcagggcctaatgggacaccggctggtcacatcccag
cagcagcaacagcaccaacagcaaggatccatgactgggctttcccatcttcagcagggt
ctgatgccacacaatgggcagcccaaactgggtgctcagcccatggccgccttgcagcag
caacagttgcaacagcagcagcagcagcagcaacttcaacaacaccaacagcttcaacaa
cagcagcagcaacagcagctacaacagcagcagcagcagttacaacagcagcagcagcag
caacagcagctacaacaacagcagcaacagcaacagcagcttcaacagcaacagcagctt
caacagcagcagcagcagcagcttcagcagcagcagcagcagcttcaacagcagcagcag
cagcaacagcagcttcaacagcagcagcagcttcaacagcagcagcagcaacagcagctt
cagcagcagcagcagatgggcctcttgagccagagtcgagctttactgtctcctcaacag
caacagcagcagcaacagatgacacttggccctggcatgccagccaagcctctgcaacac
ttttctagccccggagccctgggcccaaccctcatcctaacgggcaaggaacaaagcatc
gtagagacggctcttccttcagaggccagtgaggggccctccacacatcagggagggccc
ttaccaatgggtactgtaccagagtccgtggccactgaaccaggagaggtgaagccctca
ctgtctggggactcacaactcctgcttgtccagccccaggcccagcctcagcccaattct
ctgcagctgcagccacctctgaggctcccaggacaacagcagccgccagttaacttgctc
cacacagcaggcgcaggaagccatgggcaaccaggcagtggatcatctgaggcctcgtct
gtgccccacctactggcccaatcctctgtttccttaggggaacagcctggatccgtgacc
cagaaccttctgagctcccaacagccccttggactagagcggcctatgcaaaataacata
gggccacagcctgccaagccgggatctgtcccgcagtctgggcagagcctgccaggggct
ggggtcatgcctacagtgggtcagcttcgggcacagctccaaggagtcctggccaaaaac
ccacagctgcggcatttgagccctcagcagcagcagcagctccacgcgcttctcatgcag
aggcagctacagcagagtcaggcagcacgccaggccccaccctaccaggagcctgggacc
cagccctctcccctccaaggcctcctgggccgccagccccaacttgggggcttccctgga
tcccagacaggccctcttcaggagctaggggccgggcttcgacctcagggcccaccccga
ctccccgccccacaaggagccttatccacaggaccagttcttggccctgtccatcccaca
cctccaccatccagcccccaagagccaaagagaccttcctccgaattaccttcccctagc
tcccagctcccctcagaggcccagctccctatcacccagccaggaacccccaagccccag
gggccacccttggagcttcctcctgggagggtctcacctgctgctgcccagcttgcggat
accttctttggcaagggactgggaccttgggaccccccagaccacctagtggaagcccag
aagctggagcaaagcagcctggtacctgggcatctggaccaggtgaatgggcaggtggta
cctgagccaccacatctcaacatcaagcaggagcctcgggaagagccgtgtgccctgggg
tcccaggcggtgaagagggaggccaacggggagcctgtaggggcaccaggtaccagcaac
cacctcctgctagcagggccccgctcagaagccgggcatctgctcttgcagaagcttcta
cgagcaaagaatgtgcaactcagtactgggcgggggcccgaggggctgcgagctgagatc
aacgggcacattgacagcaagcttgctgggctggagcagaaactgcagggtacccccagc
accaaggaggatacagcagcaaggaagcctttgacaccgaagcccaagcgggtacagaag
gcaagcgacaggttggtgagctcccgaaagaagctgcggaaggaggacggggtcagggcc
agcgaggccttgctgaaacagctgaaacaggagctgtccctgctgcccctcacggagcct
accatcaccgccaactttagcctctttgctccctttggcagtggctgcccgatcagtggg
cagtgccagctgagaggggccttcggaagtggggtgctgcccacgggccctgactactat
tcccagctgcttaccaagaataacctgagtaacccgccgacaccaccctcgtcgctgccc
cccaccccacccccatcggtgcagcagaagatggttaatggcgtcactccatctgaagag
ctgggggagcaccccaaggatgccacctctgcccgggatactgaaggggtgctgagggat
gcttcagaagtgaaaagtctagacctgctggccgctttgcctacgccccctcacaatcag
actgaggatgtcaggatggagagtgatgaggacagcgattctcctgacagcatcgtgcca
gcttcatcccctgagagcatcctgggggaggaggccccccgtttccctcagctgggctca
ggccggtgggagcaggatgaccgggctctctcccctgtcatccccatcattcctcgggcc
agcattccagtcttcccagagagcaaaccttatggggtcctggatctggaggccaccagg
aagctgcctgccccaacttgggaaaagggcaaaggaagcgaggtgtcagtcatgctgact
gtttctgctgctgccgccaagaacctgaatggcatgatggtggcagtggcagagctgctg
agcatgaagatccccaattcctatgaggtgctgttcccagagagccctgcccgggccggc
atcgagcctaagaagggggaggctgagggccctggtgggaaagaaaagagtctgggaggc
aagagcccagaggctggccctgattggctgaagcagtttgatgctgtgttgcctggctat
acactcaagagtcagttagacatcttgagtctcctcaaacaggagagccctgccccagag
ccccccacccagcacagctacacctacaacgtctccaacctggatgtgcgacagctctcg
gccccacctcctgaagaaccctccccacccccttcccctctggcaccctctcctgccagc
ccgnctcgcccaccgatcccctcgcctctgccactggcctcgtcccctgaatctacccgg
cccaagccccgagcccggcctcctgaggaaggtgaagattcccggccccctcgcctcaag
aagtggaagggggtgcgctggaagcggctccggctgctgctgactatccagaagggtggt
gtgcggcaggaggatgagcgggaagtggctgagttcatggaacagctcggcacagccttg
cgacctgacaaggtgcctcgagacatgcggcgctgctgcttctgtcatgaggagggggat
ggggccacggatgggcctgcccgcctgctgaacctggacttggacttgtgggtgcacctc
aactgtgccctgtggtctacagaggtatatgagacccagggcggggcgctgatgaacgtg
gaggttgccctgcaccgaggcctgctcaccaagtgctccctgtgccagcgcaccggtgcc
accagcagctgcaatcgaatgcgttgccccaacgtctaccattttgcctgcgccatccgc
gccaagtgcatgttcttcaaggacaagaccatgctgtgtccaatgcataagatcaaaggg
ccctgtgagcaggagctgagctcttttgctgtcttccggagggtctacatcgagcgggat
gaggtgaagcagattgccagcatcatccagcggggagagcggctgcacatgttccgggtg
ggcggccttgtgttccacgccattggacagctgctgccccaccagatggctgacttccac
agtgccaccgccctctatccagtgggctacgaggccacgcgcatctactggagcctccgc
actaacaaccgtcgctgctgctaccgctgctccatcggcgagaacaatgggcggccggag
ttcgtgatcaaagtcatggagcagggcctggaggacatggtcttcacggatgcctctccc
caggccgtttggaatcgcattattgagcctgtggcagccatgaggaaagaggccgacatg
ctgcgtctcttccctgagtacctgaaaggcgaggagctctttgggctgacagtgcacgcc
gtgctgcgcatagctgaatcactgcctggagtggaaagctgtcaaaattatttattccgc
tatggacgccaccccctaatggagctaccgctcatgatcaaccccactggctgtgctcgg
tcagagcctaaaatcctcacacactacaaacggccccacactctgaacagcaccagcatg
tccaaggcatatcagagcaccttcacaggcgagaccaacaccccgtacagcaagcagttt
gtgcactccaagtcatctcagtaccggcggctgcgcactgagtggaagaacaatgtctac
ctggctcgctcccgtatccagggcctgggtctctatgcagccaaggacctagaaaagcac
acaatggtcatcgagtacattggcaccatcattcgcaatgaagtggccaaccggcgggag
aaaatctatgaggagcagaatcgaggcatctacatgtttcgaataaacaacgaacatgtc
attgatgctacgttgaccggaggccccgccaggtacattaaccattcttgtgcccctaac
tgtgtggcggaagttgtaacatttgacaaggaggacaaaatcatcatcatctccagccgg
cgaatccccaaaggagaggagctgacatatgactatcagtttgattttgaggacgatcag
cacaagatcccctgccactgtggagcctggaattgtcggaaatggatgaactaa

DBGET integrated database retrieval system