KEGG   Pantholops hodgsonii (chiru): 102337526Help
Entry
102337526         CDS       T02909                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:phd00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102337526 (F13A1)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102337526 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102337526
NCBI-ProteinID: XP_005971795
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MSESSETTFGGRRAIPRNTSNAAENDPPTVELQGLVPRGFNPQDYLNVMNVHLFKERWDS
NKVDHHTDKYSNNQLIVRRGQSFYVQIDFNRPYDPRRDFFRVEYVIGRYPQENKGTYIPV
PVVSELQSGKWGAKVVMREDRSVRLSVQSSPDCIVGKFRMYVAVWTPYGVIRTTRNPETD
TYILFNPWCEEDAVYLDNEKEREEYILNDIGVIFYGDFNDIKSRSWSYGQFEDGILDTCL
YVMDRANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGVPPSAWTGSVDIL
LEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDSPFVFAEVNSDLVYITAKKDGTHVVETLDTTHIGKLIVTKEIGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKARNTEGVLKSRSDVHMNFEVENAVLGRDLKVIITF
RNNGSTRYTVAAYLSGNISFYTGVSKAEFKNETFNVTLEPLSSKREEVLIGAGEYMGQLL
EQAFLHFFVTARVNETRDVLAKQKSIVLTVPKVIIKVRGAQVVGSDMVVMVEFTNPLKET
LRNVWIRLDGPGVTKPLRRMFREIRPNATVQWEELCRPWVSGPRKLIASLTSDSLRHVYG
ELDLQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtcctccgagaccactttcggaggcaggagagccatcccccgcaacacctcc
aatgcagcagagaacgacccccccactgtggagctgcagggcctggtgccccggggcttc
aacccgcaagactaccttaatgttatgaatgttcacctgttcaaggagaggtgggatagc
aacaaagtggaccaccacaccgacaaatacagcaacaaccagctgattgtacgtagagga
cagtctttctacgttcagatcgacttcaatcgtccctatgaccccagaagggatttcttc
agggtggagtatgtcattggtcgctacccccaggagaataagggaacctacattccagtc
cctgtggtctctgagctgcagagtggcaagtggggggcgaaagtggtcatgagagaggac
aggtctgtccgtctgtctgtccagtcttctccagactgcattgtggggaagttccgcatg
tacgtggctgtctggaccccctatggggtcatccgcaccacccgaaaccccgaaacggac
acatacattctcttcaacccttggtgcgaagaggatgctgtgtacctggataatgaaaaa
gaaagagaagaatacatcctgaatgacatcggggttattttttatggagacttcaatgac
atcaagagcagaagctggagctatggtcagtttgaggatggcatccttgacacgtgcctg
tatgtgatggacagagcgaatatggacctttccggcagaggcaatcccatcaaagtcagc
cgtgttgggtctgccatgatcaatgccaaggacgatgaaggcgtcatcgctggctcctgg
gacaacgtctacgcttacggtgttcccccatcagcctggacaggaagtgtggacatcctg
ctggaatacaagagctctcagaaaccagtccgctatggccaatgctgggtttttgctggt
gtctttaatacgtttttgcgatgcctggggataccagcaagagtcgtcaccaactatttc
tcagcccatgacaatgatgccaacttgcaattggacattttcttggaagaagatgggaac
gtgaactccaaactcaccaaggattcggtgtggaactaccactgctggaacgaagcctgg
atgacgaggccagaccttcccgttgggtttggaggttggcaagtcgtggacagcaccccc
caggaaaacagcgatgggatgtatcggtgtggccccgcctctgttcaagccatcaagcac
ggccacgtctgcttccagtttgactcacccttcgtttttgcagaggtcaacagtgacctt
gtttacattacagctaagaaagatggcactcatgtggttgaaacccttgataccacccac
attgggaaattaattgtgaccaaagaaattggaggagatggcataaaggacatcacggac
acctacaaattccaggaaggtcaagaagaagagaggctggccctggaaaccgccctgatg
tatggggcaaaaaaggcccgcaacacagagggcgtcctcaaatccaggtctgatgtccac
atgaactttgaagtagagaatgccgtgctgggcagggacttgaaggtcatcatcaccttc
cggaacaacggctccacgcgctacactgtcgcagcctatctctccggcaacatcagcttc
tacaccggggtctccaaggcggaattcaagaacgagaccttcaatgtgaccctggagccc
ttgtcctccaagagagaggaggtgctgatcggagcgggcgagtacatgggccagctgctg
gagcaggccttcctgcacttctttgtcacggctcgagtcaacgagaccagggatgttctg
gccaagcagaagtccattgtgctgacggtccccaaggtcatcatcaaggtccgtggtgct
caggtcgtgggttccgacatggtggtgatggttgagttcaccaatcctttaaaagaaaca
ctgcgcaatgtctggatccgcctggatggtcccggagtgacgaaacccttgaggaggatg
ttccgggaaatccggcccaacgccactgtgcagtgggaagagctgtgtcggccctgggtc
tctggcccccggaagctgatcgccagcctgactagcgactccctgaggcacgtgtacggc
gagctggacttgcagattcagaggcgaccttcgatgtag

DBGET integrated database retrieval system