KEGG   Pantholops hodgsonii (chiru): 102337670Help
Entry
102337670         CDS       T02909                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00010  Glycolysis / Gluconeogenesis
phd00052  Galactose metabolism
phd00500  Starch and sucrose metabolism
phd00520  Amino sugar and nucleotide sugar metabolism
phd00524  Neomycin, kanamycin and gentamicin biosynthesis
phd01100  Metabolic pathways
phd01200  Carbon metabolism
phd04910  Insulin signaling pathway
phd04911  Insulin secretion
phd04917  Prolactin signaling pathway
phd04922  Glucagon signaling pathway
phd04930  Type II diabetes mellitus
phd04950  Maturity onset diabetes of the young
phd05230  Central carbon metabolism in cancer
Module
phd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102337670 (GCK)
   00052 Galactose metabolism
    102337670 (GCK)
   00500 Starch and sucrose metabolism
    102337670 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102337670 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102337670 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102337670 (GCK)
   04910 Insulin signaling pathway
    102337670 (GCK)
   04922 Glucagon signaling pathway
    102337670 (GCK)
   04917 Prolactin signaling pathway
    102337670 (GCK)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102337670 (GCK)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102337670 (GCK)
   04950 Maturity onset diabetes of the young
    102337670 (GCK)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102337670 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102337670
NCBI-ProteinID: XP_005957763
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MLDDRARMEIAKKEKAEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYVSECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSLNPGQQLYEKLIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLRPS
ATDCDIVRRACESVSTRAAHMCAAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHAIVRRLTPSCEITFIESEEGSGRGAALISAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacagagccaggatggagatcgccaagaaggaaaaggcggaacagatcctg
gcagagttccagctgcaggaggaggacttgaagaaggtgatgaggcggatgcagaaggag
atggaccgaggcctgaggctggagacccacgaggaggccagtgtgaagatgctgcccacc
tacgtgcgctccactccagagggctcagaagttggggacttcctctccctggacctggga
ggcaccaacttccgggtgatgctggtgaaggtgggagaaggcgaggcaggacagtggagt
gtgaagaccaagcaccagatgtactccatccccgaggatgccatgacgggtactgctgag
atgctcttcgactacgtctcggagtgcatctctgactttctggacaagcatcagatgaag
cacaagaagctgcccctgggcttcaccttctcctttcccgtgaggcacgaagacattgac
aagggcatccttctcaactggaccaagggcttcaaggcctcgggagcagaaggcaacaac
attgtggggctcctgcgagatgctatcaaacggagaggtgactttgagatggacgtggtg
gcgatggtgaatgacactgtggccacaatgatctcctgctactatgaagaccgccggtgt
gaggttggcatgattgtgggcacgggctgcaacgcttgctacatggaggagatgcagaac
gtggagctggtggaaggggacgagggccgcatgtgtgtcaacaccgagtggggcgccttc
ggggactcaggcgagctggacgagttcctgctggagtacgaccgcgtggtggacgagaac
tccctgaacccggggcagcagctgtacgagaagctcattggtggcaagtacatgggcgag
ctggtgcggcttgtgctgctgaagcttgtggacgagaatctgctcttccacggcgaggcc
tcggagcagctgcgcacgcgtggcgccttcgagacacgcttcgtgtctcaggtggagagc
gattccggtgaccgcaagcagatctacaatatcctgagcacgctagggctgcgaccctcg
gccactgactgtgacatcgtgcgccgagcctgcgagagcgtgtccacgcgcgctgcgcac
atgtgcgccgcgggactggcgggggtcatcaaccggatgcgcgagagccgcagcgaggac
gtgatgcgcatcaccgtgggcgtggacggctccgtgtacaagctgcaccccagcttcaag
gagcggttccacgccatcgtgcgcaggctgacgcccagctgtgaaatcaccttcattgag
tcggaggagggcagcggccggggcgcggccttgatctccgcggtggcctgtaagaaggcc
tgcatgctgggccagtaa

DBGET integrated database retrieval system