KEGG   Pantholops hodgsonii (chiru): 102337952Help
Entry
102337952         CDS       T02909                                 

Definition
(RefSeq) thymidine kinase-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-GeneID: 102337952
NCBI-ProteinID: XP_005965868
LinkDB All DBs
Position
Un
AA seq 183 aa AA seqDB search
MNAGKSTMLLQASYNYQERGMRTLIFTAAFDNRAGVGRVASRIGLSSDALTFDENTDLFA
EVSALNAEAPVACVFIDEANFLSEHHVWQLADIADRLNIPVMTYGLRTDFQGKLFPASKE
LLAIADELREIRTICHCGRKATMVARFDNEGKVVTEGAQIEVGGNEKYVSFCRRHWVETV
KGG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccggcaaatcgaccatgctgctgcaggcgtcctataattatcaggaacgcggc
atgcgcacgctgatcttcaccgccgccttcgacaaccgggcgggtgtcggccgcgtcgcc
tcgcgcatcggcctgtcctccgacgccctgaccttcgatgaaaataccgacctcttcgcc
gaggtatcggcccttaatgccgaagcaccggtcgcctgcgttttcatcgacgaagccaat
tttctctccgagcatcacgtctggcagctggccgacattgccgacaggctgaatattccg
gtcatgacctatggcctgcgcacggattttcagggcaagctattccccgcctcgaaggaa
ctgctcgccatcgccgacgagcttcgcgaaatccgcaccatctgccattgcggccgcaag
gcgacgatggtggcccgtttcgacaatgaaggaaaggtcgtgacggaaggcgcgcagatc
gaggtcggcggcaatgaaaaatacgtttccttctgccgccgccattgggtggagaccgtc
aagggcggctga

DBGET integrated database retrieval system