KEGG   Pantholops hodgsonii (chiru): 102338625Help
Entry
102338625         CDS       T02909                                 

Definition
(RefSeq) histone H3.1-like
  KO
K11253  histone H3
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05034  Alcoholism
phd05202  Transcriptional misregulation in cancer
phd05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:phd00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    102338625
  Immune diseases
   05322 Systemic lupus erythematosus
    102338625
  Substance dependence
   05034 Alcoholism
    102338625
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102338625
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102338625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102338625
NCBI-ProteinID: XP_005960876
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaactaagcagactgctcggaagtctaccggcggcaaggcgccgcgcaaacag
ctcgccaccaaggcggcccgcaagagcgcgccggccaccggcggtgtgaagaaaccgcac
cgctaccggcccggtacggtagctctgcgcgagatccgccgctatcagaagtccacggaa
ctgctgatccgcaagctgccgttccagcggctggtgcgcgaaatcgctcaagacttcaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctat
ctggtggggctcttcgaggacactaacctgtgtgctatccacgctaagcgtgtcactatc
atgcccaaggacatccagcttgctcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system