KEGG   Pantholops hodgsonii (chiru): 102341967Help
Entry
102341967         CDS       T02909                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04080  Neuroactive ligand-receptor interaction
phd04972  Pancreatic secretion
phd04974  Protein digestion and absorption
phd05164  Influenza A
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102341967
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102341967
   04974 Protein digestion and absorption
    102341967
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102341967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phd01002]
    102341967
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phd04147]
    102341967
Enzymes [BR:phd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102341967
Peptidases [BR:phd01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102341967
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102341967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 102341967
NCBI-ProteinID: XP_005981913
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLISDQWVVS
AAHCYQYHIQVRLGEHNIDVVEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASTGTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGQIT
NNMICAGFLEGGKDSCQGDSGGPVACNGELQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccctgctgatccttgcctttgtgggagctgctgtggctttcccctcggacgac
gatgacaagatcgtcgggggctacacctgcgcggagaattccgtcccttaccaggtgtcc
ctgaatgctggctaccacttctgcgggggctccctcatcagtgaccagtgggtggtgtcc
gcggctcactgctaccagtaccacatccaggtgaggctgggagaacacaacattgacgtc
gtggagggtggtgagcagttcatcgacgcgtccaagatcatccgccaccccaagtacagc
agctggactctggacaatgacatcctgctgatcaaactctccactcctgcggtcatcaat
gcccgggtgtccaccttggctctgcccagtgcctgtgcttccacgggcaccgagtgcctc
atctccggctggggcaacaccctgagcagtggcgtcaactacccggacctgctgcagtgc
ctggaggccccactgctgagtcacgccgactgtgaagcctcataccctggacagatcact
aacaacatgatctgtgctggcttcctggagggaggcaaggattcctgccagggtgactct
ggcggccctgtggcttgcaacggagagctccagggcattgtgtcctggggctatggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactacgtggactggattcag
gagaccatcgccgccaacagctaa

DBGET integrated database retrieval system