KEGG   Pantholops hodgsonii (chiru): 102343556Help
Entry
102343556         CDS       T02909                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd01524  Platinum drug resistance
phd03440  Homologous recombination
phd04064  NF-kappa B signaling pathway
phd04068  FoxO signaling pathway
phd04110  Cell cycle
phd04115  p53 signaling pathway
phd04210  Apoptosis
phd04218  Cellular senescence
phd05165  Human papillomavirus infection
phd05166  Human T-cell leukemia virus 1 infection
phd05170  Human immunodeficiency virus 1 infection
phd05202  Transcriptional misregulation in cancer
phd05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102343556 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102343556 (ATM)
   04068 FoxO signaling pathway
    102343556 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102343556 (ATM)
   04210 Apoptosis
    102343556 (ATM)
   04115 p53 signaling pathway
    102343556 (ATM)
   04218 Cellular senescence
    102343556 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102343556 (ATM)
   05206 MicroRNAs in cancer
    102343556 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102343556 (ATM)
   05170 Human immunodeficiency virus 1 infection
    102343556 (ATM)
   05165 Human papillomavirus infection
    102343556 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102343556 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102343556 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phd03032]
    102343556 (ATM)
   03400 DNA repair and recombination proteins [BR:phd03400]
    102343556 (ATM)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102343556 (ATM)
Protein kinases [BR:phd01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102343556 (ATM)
DNA replication proteins [BR:phd03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102343556 (ATM)
DNA repair and recombination proteins [BR:phd03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    102343556 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head
Motif
Other DBs
NCBI-GeneID: 102343556
NCBI-ProteinID: XP_005955634
LinkDB All DBs
Position
Un
AA seq 3054 aa AA seqDB search
MSLALNDLLICCRQLELDRATERKREIEKFKRLIQDPETVRHLDQHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRTARQNVSASTQATRQKKMQEISSLVKGFIKCANKRAPRLKCQEL
LNYIIYTVKDSSSGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYCSLYLKPSQ
DINRVLVARIIQVVTKGCCSQTDGLNLKFLDFFCKAIHQARQEKSPAGLNHILAAFIIFL
KTLSVNFRIRVCELGDEILPTLLYIWTQQRLNNSLKEVIIELFQLQIYVHHPKGAKTQDK
GAYESRKWRSILYNLYDLLVNEISHIGSRGKYTSGSRNIAVKENLIELMADICHQVFNED
SRSLEISQSYTTTQKELTDYSVPCKKRKIELGWEVIKDHLQKSQNDFEIVPWLQIATQLI
SKYPASLPNCELSPLLMILYQLLPQQRHGERTPYVLRCLMEVALCQGKRSNLESSQKSDL
LKIWIKIWSITFRGISSEQIQTENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTLALTICVVPESVKIGIEKNICDVSRNSLKELIMKWLLFCQLEDDFEDSTELPPILCS
NFPHLTLEKILVSLTMKNCKAVMNFFQSVPECEQHQKDTEEPSFSEAEDLFLQTTFDKMD
FLTIVKEHTIEKHQSSVGFSVHQNLKESLDRYLLRLSEQLLSNYSSETSNSEMFVRCSSL
LVGVLGCYCYLGVLAEEEAYKSELFQKAKSLMQCAGESITLFKNKTSEEPRIVSLRNMIH
LCTSCLHNCSKHSPNKIASGFFLRLLTSKLMNDIADICKSLAFIIKKPFDFGEVESLKED
TDENQMRMEDQSYASLFNDSPANSVTDANESGKSQITIGAMNPLAEEHLSKQDLLSLDIL
KFLCMCVTTAQTNTVSFRAADIRRELLMLIDSSMLDPMRSLHLHMYLVLLKALPGEEYPL
PMEDVAKLLKPLPNVCSSYHRDQDVCKTILNHVLHVVMNLCHKNMDDENTRDAQGQFLTV
IGAFWHLTKEGKSTFSVRMALVNCLKTLLEADPYSKWSILNVKGKDLPVNEVFPQFLADN
HHQVRMLAAESINRLFQHIKRGSSTLKALPLKLQQTAFENAYFKAQEGMRELSHRTGNSE
SLDEICNRKATLLMMIAVVLHCSPVCEKQALFALCKSVKENGLEPHLVKKVLKKVSETFG
YRCLEDFMASHLDYLVLEWLNLQDPEYSVSSFPFILLNYTNIEDFYRSCYKILIPPLVIR
SHFDEVKLIANQIQEDWKSLLTDSFPKILVNILPYFAYEGTEDSGMAQQRETATKVYDML
KDESLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPPHFP
SHVIKATFAYISSCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKRHRIIKIY
HLFVSLLMNDIKSGLGGAWAFVLRDVIYTLIHYINQRPSHFMDVSLRTFSLCCDLLSRVC
HTAVTYCKDALESHLHVIVGTLIPLVDDQMEVQEQVLDLLKFLVIDNKDNENLYMTIKLL
DPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSAYDALPLTRLEGLKDLRRQLE
QHKDQMMDLMRASQDNPQDGIMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVGPID
FSTIAIQHSKDTSYTKALELFEDKELQWTFVVLTYLNNTLVEDCVKVRAAAVTCLKSILT
TKTGHSFWDIYKATTDPMLIYLQPFRTSRKKFLEVPRLDRESPLEGLDDTSLWIPQSENH
DIWLKTLTCAFLNSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTDESWRNLL
STHIQGFFTSCFKQSSQTSRSTTPANLDSESEHFFRCHVDKKSQRTMLAVVDYMRRQTRP
SSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNLDDQEKRSPTFEEGSQ
STTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHEAMW
GKALVTYDLETTISSSTRQAGIIQALQNLGLCHILSIYLRGLDHENKEWCAELQELHYQV
AWRNMQWDHCISVNKEMERTSYHELLYNALQSLRDREFSTFYESLKHARVKEVEELCKGS
LESVYSLYPTLSRLQAIGELENIGELFSRSVTDRQPSEVYMKWWKHSQLLKDSDFSFQEP
IMALRTVILEILMEKEMENSQRECFKDILTKHLVELSVLARTFKNTQLPERAIFQIKQYN
SASSGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENDPNLKLIYTECLRVCG
TWLAETCLENPAVIMQTYLEKAVEVAENYDGESNDGLRNGKMKAFLSLARFSDTQYQRIE
NYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDRKRF
LCKAVENYINCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLPLMYQ
LAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAARRSR
ITKNAPKQSSQLDEDRTEAANKIIRTIRSRRPQMVRSVEALCDAYIILANLDAAQWRTQR
KGINIPADQPIIKLKNLEDVVVPTMEIKVDPTGEYGNLVTIKSFKEQFRLAGGLNLPKII
DCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPLSQ
RSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSATHCQKKMMDVHKKSFEEKYETFME
ICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQS
AELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSK
ETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPDDESELHSTPNADDQECKRNLSDIDQSF
NKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9165 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaactcgatagagct
acagagcgaaagagagagattgagaaatttaagcgcctgattcaggatcctgaaactgtt
cgacatttagatcagcattcagattccaaacaagggaaatatttgaactgggatgctgtt
tttaggtttttacagaaatatattcagaaagaaacagaatgtctgagaacagcaagacaa
aatgtatcagcctcaacacaagccactaggcagaaaaagatgcaagaaatcagtagcttg
gtcaagggcttcatcaaatgtgcaaataaaagagcacccaggctgaaatgtcaagaactg
ttgaattatatcatatatacagtgaaagattcatccagtggtgctatttatggagctgat
tgtagcaatatattgctgaaggacattctttcagtgaggaaatactggtgtgaaatatct
cagcaacagtggctcgaattgttctctgtgtattgtagtctatatcttaaaccttcacaa
gacattaatagagtgttggtggcaagaataattcaagttgtgaccaaaggatgctgttca
cagaccgatggattaaatctcaaatttttggattttttttgtaaggctattcaccaggca
cgacaagaaaagagccctgcaggtctaaatcatatcttagcagcatttattatcttcctc
aagactttgtctgtcaactttcgaattcgagtgtgtgaattaggagatgaaattcttcct
accttactttatatttggactcaacagagacttaataattccttaaaagaagtaattatt
gaattatttcagctacaaatttatgtccatcatccaaagggagccaaaactcaagataaa
ggtgcttacgaatcaagaaagtggagaagtattttatacaacctatatgatttgctagtt
aatgaaataagtcatataggaagcagagggaaatatacttcaggatctcgtaatattgct
gttaaggaaaacttgattgaattgatggcagatatttgtcaccaggtttttaatgaagat
tctagatctttggagatttctcagtcttacacaaccacacaaaaagaacttactgattac
agtgtaccttgcaaaaaaagaaagatagaattaggctgggaagtaataaaagatcacctt
cagaagtcacagaatgattttgaaattgtaccttggttacaaattgcaactcaattaata
tcaaaatatcctgcaagtttacctaattgtgagttgtcaccattactaatgatactatac
cagcttctacctcaacagcgacatggggaacgcacaccatatgtgttacgatgtcttatg
gaagttgcattgtgtcaaggcaagaggtcaaacctagaaagctcacaaaagtcagattta
ttgaaaatctggattaaaatttggtctattacttttcgtggtataagttctgaacaaata
caaacagaaaactttggcttacttggagccataattcaaggcagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgtagaccttcatgtcctgcagtatgc
tgtttgactttggcactgacaatctgtgtagttccagaatcagtaaaaataggaattgag
aaaaatatatgtgatgtaagcagaaattctttaaaggaattgataatgaaatggctctta
ttctgtcagttagaggatgactttgaagacagtacagaactacctccaattctttgcagt
aattttcctcatcttaccctggagaaaattctcgtgagtctcactatgaaaaactgtaaa
gcagtgatgaattttttccaaagtgtgccagaatgtgagcaacaccaaaaagatacagaa
gaaccttcattctcagaagctgaagatctgtttcttcagacaacttttgacaagatggat
tttttaaccattgtgaaagaacatacaatagagaagcaccaatccagtgtaggcttttct
gtccaccaaaacctcaaggagtcactggatcgctatcttttgagactatcagaacagctt
ctaagtaactactcatctgagacttcaaattcagagatgtttgtccggtgttcaagtctt
ttggtgggtgttcttggctgctattgttacctgggtgtcttagctgaagaggaagcatac
aaatcagaattattccagaaagccaagtctctaatgcagtgtgctggagaaagtatcact
ttgtttaaaaataagacaagtgaagaacctagaattgtttcattgagaaatatgatacat
ctgtgtacaagttgcttacataactgttccaagcacagtccaaataagattgcatctggc
ttcttcttacgattattaacatcaaagctaatgaatgacattgcagatatttgtaaaagt
ttggcattcattatcaaaaagccttttgactttggagaagtagaatcactgaaagaagat
actgatgaaaatcaaatgaggatggaggatcagtcatatgcgagtctatttaatgattcc
cctgctaatagtgttactgatgcaaatgaatctggaaagagccaaattactattggtgcc
atgaatcctttagctgaagaacatctatcaaagcaagatctactttctttagacatactc
aagttcttgtgtatgtgtgtaaccactgctcagactaacactgtgtcatttagggcagct
gatattcgaagggaattattaatgttaattgattctagcatgctagatcctatgagatct
cttcatttacacatgtatctagtgcttttaaaggcacttcctggagaagaatatcccttg
ccaatggaagatgttgcaaaacttctaaaaccactacccaatgtgtgttcatcttatcac
cgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcacgtagtgatgaaccta
tgtcacaaaaatatggatgatgagaacacaagggatgctcaaggacagtttctaacagtg
attggagcattttggcacttaacaaaggagggaaaaagtacattctctgtaagaatggca
ctagtaaactgccttaaaactttgcttgaggctgatccttattcaaaatggtctattctg
aatgtaaagggaaaagatcttcctgtaaatgaagtatttccacagtttcttgctgataat
catcaccaagttcgcatgttggctgcagagtcaatcaatagattgtttcagcatataaaa
cgaggttcttccacattgaaagcacttcctttgaagcttcagcaaacagcttttgaaaat
gcatactttaaagctcaggaaggaatgagagaattgtcccacagaactggaaactctgaa
agtttggatgagatttgtaatagaaaagccactttactgatgatgatagctgtggtgtta
cactgcagccctgtctgtgaaaagcaggctttattcgccctatgcaagtctgtgaaagag
aatggactagagcctcaccttgttaaaaaggttttaaagaaagtttctgagacttttgga
tatagatgtttagaagatttcatggcttctcatttggattatttggtattggaatggcta
aatcttcaagatcctgaatacagtgtatcttcttttccttttattttattaaattacaca
aatattgaagatttctataggtcttgttataaaattttgattccacctttagtgattaga
agtcattttgatgaagtaaagttaattgctaatcaaattcaagaggattggaaaagtctt
ctgacagactcctttccaaagattcttgtaaatattcttccatactttgcatatgagggt
acagaagacagtgggatggcacagcaaagagagactgctaccaaagtctatgatatgctt
aaagatgaaagcttactaggaaaacagattgatcatttattcattagtaatttaccagag
attgtagtggagttattgatgacgttacatgaaccagcaacttctggtgccagccaaagc
actgacccctgtgacttctcgggggatttggatcctgctcctaatccacctcattttcca
tcacatgtgattaaagccacatttgcctatatcagcagttgccataaaaccaagcttaaa
agcattttagaaattctttccaaaagccctgattcctatcagaaaattcttctagccata
tgtgagcaagcagctgagacaaataatgtttacaaaaggcacagaattattaaaatatat
cacctgtttgttagtttattaatgaacgatataaagagtggcttaggaggagcttgggcc
tttgttcttcgagatgttatttatactttgattcactatatcaaccaaaggccttctcat
ttcatggatgtgtcattacgtaccttctccctttgttgtgacctattaagccgggtttgc
cacacagcggtaacttactgtaaggatgctttagaaagtcatcttcatgttattgttggt
acacttataccccttgtggatgatcagatggaagttcaggaacaggtgttggacttgttg
aaattcttagtgattgataacaaggataatgaaaatctgtatatgacaattaaactttta
gatccttttcctgaccacgttgtctttaaggatttgcgtattactcagcagaaaatcaaa
tacagtagaggacccttttcacttttggaggaaattaaccattttctctcagtaagtgct
tatgatgcacttccattaacaaggcttgaaggattgaaggatcttcgaagacaactagag
caacataaagatcagatgatggatcttatgagagcatctcaggataaccctcaggatggc
ataatggtgaagctagttgtcagcttgttgcagttatccaagatggcagtaaaccacact
ggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggtcctatagat
ttctctacaatagctatacaacatagtaaagatacatcttataccaaggctcttgagtta
tttgaagataaagaacttcagtggaccttcgtagtgctaacttacctgaataatactctg
gtagaagattgtgtcaaagtgcgagcggcagctgttacctgtttgaaaagcattttaacc
acaaaaactggacatagtttctgggatatttataaggcaacaactgatcccatgctgatc
tatctacagccttttagaacatcaagaaaaaagtttttagaagtaccaagacttgacaga
gaaagtcctttagaaggcttggatgatacaagcctgtggattcctcaaagtgaaaatcat
gacatttggttaaagacactgacttgtgcttttttgaatagtggtggcacaaaaagtgaa
gtccttcagttattaaagccaatgtgtgaggtgaaaactgacttttgtcagactgtgctt
ccatacttgattcatgatattctactacaagatacagatgaatcatggagaaatctcctt
tctacacacattcagggatttttcactagctgtttcaaacagtcttcacaaacaagccga
tctacaacccctgcaaatttggattcagagtcagagcacttttttcgatgccatgtggat
aaaaaatcacaaagaacgatgcttgctgttgtggactacatgaggagacaaacgagacct
tcttcaggaacggtttttgatgatgctttctggctggagttgaattacctagaggttgcc
aaagtagctcagtcttgtgctgctcattttacagcattgctctatgcagaaatctatgca
gataagaagaacttggatgatcaagagaaaagaagtcctacatttgaagaaggaagccaa
agtacaactatttccagtttgagtgaaaaaagtaaggaagaaactgggataagtttacag
gatctgcttttagaaatctacagaagtataggagagccagatagtctttatggctgtggt
ggagggaaaatgttacaaccccttaccagactacgaacatatgaacatgaagcaatgtgg
gggaaagccttagtgacatatgaccttgagacaacaatctcttcatcaactcgtcaggca
ggaataattcaggccttgcagaatttgggactctgccatattctttccatctatttaaga
ggattagatcatgaaaataaagagtggtgtgctgaactacaggaacttcattaccaagta
gcatggaggaatatgcagtgggaccactgcatttctgtcaacaaagaaatggaaagaacc
agttaccacgagttgttgtacaatgctctgcagtctctaagagacagagaattctccact
ttttatgaaagtctcaaacatgccagagttaaagaagtggaagagttgtgtaagggcagt
cttgagtctgtgtattccctctaccctacacttagcagattgcaggccattggagagctt
gaaaacattggagaacttttctcaagatcggtaacagataggcagccctctgaagtgtac
atgaagtggtggaaacattcccagcttctcaaagacagtgattttagttttcaggagcct
ataatggccctacgcacagtcattttggagatcttgatggaaaaggaaatggaaaactcc
caaagagagtgttttaaggacattctcaccaagcatcttgtagaactctctgtattagcc
cgaactttcaagaacacacagctccctgaaagggcaatatttcaaattaaacagtataat
tcagctagtagtggagtctctgagtggcaactggaggaggcacaagtattctgggcaaaa
aaggaacagagtcttgccctgagtattctcaagcaaatgatcaagaagctggatgccagt
tgtacagagaatgatcccaacttaaaacttatatacacagaatgtctaagagtttgtggc
acttggttagcagaaacttgcttagaaaatcctgcagtcatcatgcagacctatctagaa
aaggctgtggaagttgctgaaaattatgatggagaaagcaatgatgggctgagaaatgga
aaaatgaaggcatttctctcattagcacggttctcagatactcagtaccaaagaattgaa
aactacatgaaatcctcagaatttgaaaataagcaagctcttctgaaaagagccaaagag
gaagttggcctacttagggaacataaaatccagaccaacagatacacagtaaaggttcag
cgagagctggagttggatgaatgtgcactccgtgcgttgaaagaggatcgtaaacgtttc
ttatgtaaagcagttgaaaattacatcaattgcttattaagtggtgaagggcatgatatg
tggatatttcgtctttgttctctctggcttgaaaattctggagtttctgaagtcaatggc
atgatgaagagagatggaatgaagattccatcatacaaatttttgcctcttatgtaccaa
ttggctgctagaatggggaccaagatgatgggaggcctaggatttcacgaagtcctcaat
aatctcatctctagaatttcaatggatcatcctcatcacactttgtttatcatattggcc
ttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagccagaaggagtaga
attactaaaaatgcacctaaacaaagctcacagcttgatgaggatcgaaccgaggctgct
aacaaaataatacgtactatccgaagtaggagacctcagatggtcagaagtgttgaggca
ctttgtgatgcttatattatactagcaaatttagatgccgctcagtggaggactcagaga
aaaggcataaatattccagcagaccagcccattatcaaacttaaaaatttagaagatgtt
gttgtccctactatggaaattaaggtggaccccacaggagaatatggaaatctggtgact
ataaagtcatttaaagaacaatttcgtttagcaggaggtttaaatttaccaaaaataata
gattgtgtgggctctgatggaaaggaaaggagacagcttgtcaagggccgtgatgacctg
agacaagatgccgtcatgcagcaggttttccagatgtgtaatacattactgcagagaaat
actgaaaccaggaagaggaaattgactatttgcacttataaggtggttcccctttctcag
cgaagtggtgttcttgaatggtgcacaggaactgtccctattggtgaatttcttgttaac
aatgagaatggtgctcataaaagatacaggccaaaggatttcagtgccactcactgccaa
aagaaaatgatggatgtgcataaaaagtcttttgaagagaaatatgaaactttcatggag
atttgccaaaattttcaaccagttttccgttacttctgcatggaaaaattcttggatcca
gcagtgtggtttgagaagcggttggcttatactcggagtgtggctacttcttctattgtt
ggttacatacttggactaggtgatagacatgtacagaatatcttgataaatgagcagtca
gcagaacttgtacatatagatttaggagttgcttttgaacagggcaaaatccttcctact
cctgaaacagttccttttagacttaccagagatattgtggatgggatgggcattactggt
gttgaaggtgtcttcagaagatgctgtgagaaaaccatggaggtaatgagaaattctaag
gaaaccctgttaaccattgtagaggtcctcctatatgatcctctctttgactggaccatg
aatcctttaaaagctttatatttacaacagaggccagatgatgaaagtgagctccattcc
actccaaatgcagatgaccaggaatgcaaacgaaatctcagtgatattgaccagagtttc
aataaagtagctgaacgtgtcttgatgagactgcaagagaaactaaaaggagtagaggaa
ggaaccgtgctcagtgttggtggacaggtgaatttgctcatacagcaggccatggacccg
aaaaatctcagccgacttttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system