KEGG   Pantholops hodgsonii (chiru): 102344595Help
Entry
102344595         CDS       T02909                                 

Definition
(RefSeq) phosphoenolpyruvate phosphomutase-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 102344595
NCBI-ProteinID: XP_005967806
LinkDB All DBs
Position
Un
AA seq 310 aa AA seqDB search
MSYVGESGLSTTAVSAAARPSLRGIIQANTLGFIMEAHDALSATIAERAGFKGLWASGLS
IASSLGYRDANEASWTQLVEVVERMADAASIPILVDGDSGFGNFNNARLAARKLFQHGAA
GVCLEDKGFPKMNSFVGDRHPLAEISEFCGRLRAVKDTLGSEDFVLVARVEALIAGYDQQ
EALMRAHAYADAGADAILIHSRKSDAGEILAFAREWSNRLPLVIVPTKYYRTPVDEYRAA
KISTVIWANHNMRAAVSAMRQVCERILREGTIAGIENEVATLDDVFDLLNYRELAEAETR
YLPSVAVAAE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacgttggagaatccggcctttcaaccacagccgtttcggcagcagccaggcca
agcctgcgcggaataatccaggccaatacgctcggtttcatcatggaagcgcatgacgcg
ctttcagcaaccatcgcggaacgcgcgggcttcaagggcctctgggcttccggcctatcg
attgcctcgagcctcggttaccgcgatgccaatgaagcatcctggacacagctcgtcgaa
gtcgtcgagcggatggccgatgcagcctcaatccccatcctggtggatggagacagcggc
ttcggcaatttcaacaatgccaggctcgcggccaggaagctcttccagcacggcgcggcc
ggtgtctgcctcgaggacaagggcttccccaagatgaactcctttgtcggtgaccgtcac
ccgctggcggaaatcagtgagttctgcggacggctgcgcgcggtgaaggacacgcttggt
tccgaggactttgttctggtcgcacgcgtcgaggcgctgatcgcgggttacgaccaacag
gaagcgctgatgcgtgcgcatgcctatgcggacgccggcgccgatgcgatcctcatccac
tcgcgtaagtcggacgccggcgagatcctggccttcgcccgggaatggagcaatcgcctg
cccctcgtgatcgtcccgaccaaatactaccgcacgcccgtcgatgagtaccgtgcggcc
aagatctcgacggtgatctgggccaaccacaacatgcgcgcggccgtctcggccatgcgc
caggtctgcgaacgcatccttcgcgaaggaacgatcgccggcatcgaaaacgaggtcgcc
acgctggacgatgtgttcgacctgctcaactaccgcgaactggcggaggccgagacgcgc
taccttccttcggtcgcggtcgcggccgagtag

DBGET integrated database retrieval system