KEGG   Pantholops hodgsonii (chiru): 102344626Help
Entry
102344626         CDS       T02909                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd03030  DNA replication
phd03410  Base excision repair
phd03420  Nucleotide excision repair
phd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:phd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102344626 (LIG1)
   03410 Base excision repair
    102344626 (LIG1)
   03420 Nucleotide excision repair
    102344626 (LIG1)
   03430 Mismatch repair
    102344626 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phd03032]
    102344626 (LIG1)
   03400 DNA repair and recombination proteins [BR:phd03400]
    102344626 (LIG1)
Enzymes [BR:phd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102344626 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102344626 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102344626 (LIG1)
DNA replication proteins [BR:phd03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102344626 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102344626 (LIG1)
DNA repair and recombination proteins [BR:phd03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102344626 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102344626 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102344626 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR DNA_ligase_OB_2 PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 102344626
NCBI-ProteinID: XP_005955394
LinkDB All DBs
Position
Un
AA seq 924 aa AA seqDB search
MQRSIRSFFQPKKEGKVKKPEKETSNTIRETESPPKVALKERNRVVSDGDSPVKRPGRKA
TRVLGSEGEEEEEEAPTTPRSQEPALDSPQPSPPSPVTLPESSPSRSSTPPAVASPSGIP
KRRTARKQLPKRTFQDVLKEEGEDEDPETKKKKEEGEAETPTESLPEPEEGDKEEVEGRD
QPTTPPEPQTSSESESPTESVSEPGVTVKQEPQEDGQAQPPPKAPKTLSSFFSPRKPAVK
KEAKEEGPGALRKDETKGHLDPPSYNPAKNNYHPIEDACWKAGQRVPYLAVARAFEKIEE
VSARLRMVETLSNLLRSVVALSPADLLPVLYLSLNRLGPPXELGIVVGILLKAVAQATGR
QLESVRAEVAEKGDVGLVAESSRSTQRLVLPPPALTAAGVFAKFRDIAQLAGSASTTKKM
DVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQECPLAVVDAG
KGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSPGVPLKPML
AHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIXXXXXXXXXXXXNQEDNT
GRYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQV
CLYAFDLIYLNGESLVREPLSRRRQLLRENFIETEGEFVFATSLDTKDTEQIAEFLEQSV
KDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRY
GGFLLASYDEESEEFQAICKLGTGFSDEELEEHHQRLQALVLPTPRSYVRADGAVAPDHW
LDPSDVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEQATTSAQVAG
LYKKQSQIQNQQGAEPDSEQEEFY
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcaggtcatttttccagcccaagaaagagggcaaagtgaagaagcca
gagaaggagacatccaacaccatcagagaaacggagtcccctccgaaggtggcgctgaag
gagcggaatcgagtggtgtctgacggtgactctccagtgaagaggccgggaaggaaggca
accagggtcctgggcagcgagggcgaggaggaggaagaggaagcccctaccacccccaga
agccaggagcctgctttagattctccacagccctcacctcccagtcctgtcacactgcct
gagagcagcccttcccgctccagcacccccccagcggttgcgtccccatcagggatcccg
aagcgtcgcacagcccggaagcagcttcccaaacggacatttcaagatgttctgaaagag
gagggcgaggacgaggacccggagactaagaagaagaaggaggaaggagaagcagagaca
ccaacagaaagcctcccagagcctgaagagggcgacaaggaggaagtggaaggcagggac
cagcccacgacgccccctgagccccagacctccagtgagtcagagtccccgacagaaagc
gtttcagagcccggggtgacggtgaagcaggaaccacaggaggatggccaggctcaaccg
ccccccaaagctccaaagaccctcagcagtttcttctccccccggaagccagctgtcaaa
aaagaagcgaaagaagaaggacctggtgctctaagaaaggacgagaccaagggacacctg
gacccaccgagctacaatcctgccaagaacaactaccaccccatcgaggatgcctgctgg
aaggcgggccagagggttccttatctggctgtggcccgggcgttcgagaagatcgaggag
gtctctgctcggctccggatggtggagacgctgagcaacctgctgcgctccgtggtggcc
ctgtcacctgctgacctcctacccgtcctctacctcagcctcaaccgcctggggccgccc
ncagagctcggcattgtagtgggcatccttctcaaggcagtggcccaggccacgggtcgg
cagctggagtctgtccgggccgaggtggccgagaagggtgatgtggggctggtggctgag
agcagccgcagcacccagaggctcgtgctgcccccacccgcgctcaccgccgccggcgtc
ttcgccaagttccgggacatcgcgcagctggcgggcagtgcttccaccaccaagaagatg
gatgtcatcaaaggcctctttgtggcctgccgtcactcagaggcgcgtttcattgccaga
gccctgagtggacggctgcgcctcgggctggctgagcagtcggtgctggcggcccttgcc
caggccgtgagcctcacgccccccggtcaagaatgccccctcgccgtggtggacgccggg
aagggcaagacggcagaagccagaaagacgtggctggaggagcaaggcatgatcctgaag
cagaccttctgtgaggtacctgacctggaccggatcgtccccgtgctgctggaacacggc
ctcgagcggctcccggagcactgcaggctgagcccaggggttcccctgaaaccaatgttg
gcccaccctacccggggtgtcagcgaggtcctgaagcgctttgaggaggcagctttcacc
tgcgaatacaaatacgacgggcagagggcacagattcacgttctggaaggcggggaggtg
aagatcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngaatcaggaggacaatacc
ggaaggtaccctgacatcatcagccgcatccccaagattaaactcccatcagtcacatcc
ttcatcctagacacggaagctgtagcttgggaccgggaaaagaagcagatccagccgttc
caagtgctcaccacccgcaaacgcaaggaggtggacgcggcggagatccaggtgcaggtg
tgtctgtatgcctttgatctcatctacctcaatggagagtccctggtacgtgagcccctc
tcccgacgccggcagctgctccgggagaacttcatagagacggagggcgagttcgtcttt
gccacctccctggacaccaaggacacggagcagatcgctgagttcctggaacagtcggta
aaagactcctgcgaggggctgatggtgaagaccctggacgtggacgccacctacgagatc
gccaagaggtcacacaactggctcaagctgaagaaggactacctcgagggtgtgggcgac
accctggacctcgtagtgattggtgcctacctgggcaaggggaagcgggccggccggtac
ggaggcttcttgctggcctcgtacgatgaggagagcgaggagttccaggccatctgcaag
ctcggaactggcttcagtgacgaggagctggaagagcaccaccagaggctccaggcctta
gtgctgcccaccccgcgctcctatgtccgggctgacggcgcggtggcccccgaccactgg
ctggaccccagcgatgtgtgggaggtgaagtgcgcggacctctccctgtcccccatctac
cctgcggcccggggcctggtggacagcgagaaggggatctccctccgcttcccccggttt
attcgtgtccgtgaggacaagaagccagagcaggccactactagtgcccaggtggccggt
ctgtacaagaagcagagtcagattcagaaccagcagggtgctgagccggactccgagcag
gaagagttctactag

DBGET integrated database retrieval system