KEGG   Pedobacter heparinus: Phep_0569Help
Entry
Phep_0569         CDS       T00978                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phe  Pedobacter heparinus
Pathway
phe00564  Glycerophospholipid metabolism
phe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Phep_0569
Enzymes [BR:phe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Phep_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: ACU02791
UniProt: C6Y0N0
LinkDB All DBs
Position
681684..683294
Genome map
AA seq 536 aa AA seqDB search
MVFSRESFIKQVEERNSWDVIVVGGGATGLGTAVDAASRGYSTLLLEQSDFAKGTSSRST
KLVHGGVRYLAQGDVALVYEALHERGLLLKNAPHLVKDQEFIIPVYSWLSKYKYLIGLKL
YDLLAGKSGFKKSSFLSADKVLKAIPGLKPDGLIGGVSYSDGQFDDARLALNLAQTAAEY
GGVLLNYAKVTGLTKENENISGLSFVDTETNKSYTLKAKVVVNATGVFVDEILKMDVPSG
RAIVRPSQGAHVVLDPSFLKGDSALMIPKTPDGRVLFAVPWHGKVLVGTTDTPLNEHSLE
PRPLDEEIEFILTTAGKYLTKEPSRKDVLAAFAGLRPLAAPGKDTDSTKEISRSHKLIIS
KSGMITITGGKWTTYRKMAMDVVDKAIELGKLQAKKCITQNVKIHGYVAKMQTGDLGLYG
ADAAGILELISLQPELGARLHPDYKYLQAEVIWMVRNEMSRTIEDVLSRRMRLLFLDAKG
ALILAPAVAQVMAAELQKNEAWVKEQIEAFTVLVKQYLLYAPGKETDNVHQVKVTA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttagtcgcgaatcattcataaagcaggtagaagaacggaacagttgggatgtg
atagttgttggcggtggtgctacagggttaggaaccgctgtggatgcggcaagcaggggt
tacagtactttgttgctggaacagtcggattttgcaaaaggaacctccagccgtagtaca
aaattggtgcatggcggggtaagatatttggctcagggagatgttgcgctggtttatgag
gcattgcacgaacgtggtttgctgttaaaaaatgcacctcacctggttaaagaccaggag
tttatcattcctgtttattcctggttgtctaaatataaatacctgatcggcttaaaactt
tacgacttgctggcggggaaaagcggttttaaaaaatcttcctttttatcagcggataaa
gtattaaaagcaatacctggattaaaacctgatggcttgattggtggggtgagttatagc
gacggacaatttgatgatgcccgcttggctttaaatctggcgcagacggctgccgaatat
ggcggggtgttactgaactatgcgaaggttaccgggttaacgaaagaaaacgaaaacatt
agcggactaagttttgtagataccgagaccaataaaagctataccctgaaagcgaaagta
gtggtcaatgctaccggagtatttgtagatgagatcctgaaaatggatgttccctcagga
agagcaatcgtccgtccaagccagggtgcccatgttgttttagatccttcatttttgaaa
ggggacagcgccctgatgattccaaaaacaccggatggaagggtcttgtttgctgtgcca
tggcacggaaaagtattggtaggaacaacagataccccattaaatgagcatagcctggag
ccaaggcccttggatgaagagatagagtttatattgacaacggcaggcaaatacctgaca
aaagaaccttcaagaaaggatgtattggctgcatttgcaggtttaaggccattagctgcc
ccgggtaaggataccgatagtacgaaggaaatctccagaagccataagctcatcatcagc
aaatcaggaatgattacgattaccgggggcaaatggaccacttatcgtaaaatggctatg
gatgtagtagataaagctattgaattgggcaagctacaggcaaaaaaatgtattacccag
aatgttaaaatccatggttatgttgctaaaatgcaaaccggagatctgggcttatacggt
gctgatgctgctggtatactggagctgataagcctacagcctgaacttggcgcccgtttg
catcctgattacaaatatctgcaagctgaagtgatctggatggttagaaatgaaatgtca
cgtacgattgaagatgtgctttcgcgaaggatgcgtctgttattcctggatgcgaaaggg
gctttaatacttgctccggctgttgcacaggtaatggctgccgaattgcaaaaaaatgag
gcctgggtgaaagaacagattgaagcctttactgtgctggtaaaacaatatttgttgtac
gcacccggaaaggaaactgataatgttcatcaggtgaaagttacggcctaa

DBGET integrated database retrieval system