KEGG   Pedobacter heparinus: Phep_3032Help
Entry
Phep_3032         CDS       T00978                                 

Definition
(GenBank) alanine racemase
Organism
phe  Pedobacter heparinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase RuvA_C
Motif
Other DBs
NCBI-ProteinID: ACU05230
UniProt: C6Y2M0
LinkDB All DBs
Position
complement(3623625..3626078)
Genome map
AA seq 817 aa AA seqDB search
MSSLIYNIKHIAGILGIKNFEVQKDAIISKLVIDSRSVIDPDGSLFFALKGQRDGHGFLK
DAYANGIRNFVISEAKYTRLFPDANILLVQDVLLALHTIAKYNRNQYDLKVLGITGSNGK
TIVKEWLYQLLAADHNIVRSPKSFNSQIGVPLSVWEITAIHTLGIFEAGISKTDEMDALA
SMIKPNVGILTNVGEAHAEGFVSLKEKLLEKLKLFNDADLFIYAPEYTAGLSTDDLPGKT
KFSWSKKQQADLQILFVEPIDGKNYIRADFKGIEIECLIPFSDQASVENGIICWATLLAL
GYTPEEADKRLEKLTRVSMRLELKNGINQCSVIDDSYSADISSLAIALDFLNLQNQHPKK
TLILSDIYETGKTNRVLYTEIAALLKQKHVDRLIGIGTHISESASLFDMEASFYESTQAF
IDNFPALHFNNETILVKGARRFEFERISKLIAQKVHDTVMEIDLNALAGNLQFYRSKLLP
GVKVMAMVKAFSYGSGSFEIANLLQYHKVDYLAVAYTDEGISLRKAGITLPIMVMSPEPS
AFDAIIRYNLEPEIYNIEILQGFIGFLKTDQYPIHLKIDTGMHRLGFEEPDLSDLLKVLT
ETRKVKVASVFSHLVGSEDGLHDEFTRHQIERFTAMTELISETLHYPFIRHISNTSGISR
HPETQLEMVRLGIGLYGFDAALKNNTALQTVAILKTTITQIKHLKPNETVGYGRKGLLPK
GGTIATVKIGYADGYSRAFGNGTGRMLIKGKLVPTVGVICMDMCMLDVTGLDVKTGDEVI
VFNNELSIAQLATQIGTIPYEILTNVSQRVKRVYFYE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtctcatttacaacatcaaacatattgcaggtattctgggtataaaaaacttt
gaagtacaaaaggatgcgatcatcagtaaacttgtgattgacagcagaagtgtaatagat
ccggatggctctttattttttgctttaaagggacaaagagatggacatggatttttaaaa
gatgcttatgccaatggaatccggaactttgtgatcagtgaggctaagtataccagattg
tttcctgacgccaatattttgcttgttcaggatgtgttactcgctttacataccatcgct
aaatataatcgtaaccagtatgatttaaaagtacttggtataaccggaagcaatggtaag
accattgtaaaggaatggctgtatcaattactggctgctgatcataacattgtacgcagt
cccaaaagttttaactcccagataggtgtacctctatctgtatgggaaattacggccata
catacactgggtatttttgaagcaggcatttccaaaactgatgagatggatgccttggcc
agcatgatcaaacctaatgtagggattctgacaaatgtaggagaggcacatgccgagggc
ttcgtttcattaaaagaaaaactgctcgaaaaattaaagctgtttaatgatgctgacttg
tttatttatgctcctgaatatacagcaggattaagtacagatgatttaccaggaaaaacc
aagttctcctggagcaaaaaacagcaagccgatctgcaaatcttatttgttgaaccaatt
gatggtaaaaactatatccgggcagattttaaaggaatagaaatagaatgcctgatccca
tttagtgaccaggcatctgtagaaaatgggatcatctgctgggctaccctgctggccttg
gggtatacacctgaagaagcggataaacgtctggaaaagttgaccagggtaagtatgcgc
cttgaattaaaaaacgggataaaccaatgttctgtaatagatgattcttatagcgccgat
atttcgtccctggccattgcacttgattttctaaaccttcagaaccagcatcccaaaaaa
acgctgatcttgtctgatatttatgaaacaggtaaaaccaatagggtactttatactgaa
attgcagcgctattgaaacaaaagcatgtagacaggctcattggtattggtacccatatt
agcgaatcggcctctttatttgatatggaagccagtttttatgaaagtactcaagcattt
attgataattttcctgcactccattttaataacgaaaccattttagtgaaaggggccagg
agatttgaatttgagcggatcagtaagctgattgcacaaaaagtacacgataccgtaatg
gaaattgaccttaatgcattggcaggtaacctgcagttttaccgcagtaaactactgcct
ggggttaaggttatggctatggtcaaagctttttcttacggcagtggcagtttcgaaata
gccaatttattgcagtaccacaaagtggactatctggctgttgcctatactgatgaaggc
atttcattaagaaaggctggtataacgctacctattatggtaatgagtcccgaaccttct
gcttttgatgccatcatcaggtataaccttgaacccgaaatctataacattgaaattttg
cagggttttattggctttttgaaaaccgaccaatatcctattcatctgaaaattgatacc
ggaatgcatcgactgggatttgaagaacctgatttatctgacttgttaaaggtgttgact
gaaaccagaaaagttaaagtggcttctgtattttcccatcttgtgggaagtgaagatggg
ctgcatgatgaattcacccggcatcagattgaacggtttacagccatgacagaactgatt
agcgaaacactgcactaccccttcatcaggcacatttccaatacttctggtatttcgcgc
catcctgaaacacaactggagatggtacgacttggaattggtctatatggttttgatgct
gcattaaaaaacaataccgccctccagacagttgctatcctaaaaaccaccattacccaa
ataaagcaccttaaaccaaatgaaactgtggggtatggcaggaaaggtctgttgccgaaa
ggtggtacaattgctactgtaaaaattggttatgccgatggttacagtcgtgcctttgga
aatggaacaggtcgcatgctgatcaaggggaaacttgtacccactgttggagtaatctgt
atggatatgtgtatgctggatgtaacagggctggatgtgaaaacaggggatgaggtaatt
gtgtttaacaatgagcttagcattgctcaactggctactcagatcggaactattccttat
gaaattctcactaatgtatctcaaagggtaaaacgcgtgtatttttatgaatag

DBGET integrated database retrieval system