KEGG   Providencia heimbachae: NCTC12003_00109Help
Entry
NCTC12003_00109   CDS       T05509                                 

Gene name
mrcA
Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
phei  Providencia heimbachae
Pathway
phei00550  Peptidoglycan biosynthesis
phei01100  Metabolic pathways
phei01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC12003_00109 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NCTC12003_00109 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phei01003]
    NCTC12003_00109 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
    NCTC12003_00109 (mrcA)
Enzymes [BR:phei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NCTC12003_00109 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NCTC12003_00109 (mrcA)
Glycosyltransferases [BR:phei01003]
 Polysaccharide
  Bacterial polysaccharide
   NCTC12003_00109 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NCTC12003_00109 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: SQH11449
LinkDB All DBs
Position
1:127425..129956
Genome map
AA seq 843 aa AA seqDB search
MKFVKYFFIFVICCIFLGTASIFGMYKYVEGELPDVATMKDIRLQVPMQVFSADNELIAQ
YGEKRRIPLPLNEIPPLMVKAFIATEDSRFYDHHGIDPIGIFRAVTVMASSGHASQGAST
ITQQLARNFYLSPEKTLMRKAKEAFLAIRIEQLFTKDEIMELYLNKIYLGNRAYGVGAAA
YVYFGKTASELTLSEMAMIAGLPKAPSTFNPLYSYERAVNRRNVVLMRMLEEKYITQDQY
EQARNEKIEASYHAPKVDFSAPYLAEMARQTLYDKYGEDAYTDGYKIYTTVIRKDQLAAT
EAVRNNLIDYDVRHGYRGPTEVLWKPSEAAWPAEKIVEKLKKSPVYGPLMPAVVLSTTNN
DAKVLLADGTEAQITMAGVRWARKYISDTQQGATPRTVNSVVQAGEQIWVRQVKDNLWLA
QVPDVNAAFVALNPNDGAIIALVGGFDFNMSEFNRVTQSLRQVGSNIKPFLYTAAMDKGL
TLSSLLNDVPISRWDAGAGSDWRPKNSPPRYDGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AADYLTRFGFPAENINRTEALALGAPSFTPMQMVRGYAVMVNGGYLVDPYYILKIENHDD
EVIFEAKPKIACPDCTHIPVVYGDTERSITVEGVDDASTEEVTQSGSGVAVQEPTMELAT
ASEQGANSGDMYAPHVIGTPLAFLIRDAMMTNIYGEPGWSGTGWRAARDLGGRRDIGGKT
GTTNSSKDAWFSGYGPDVVASAWIGFDDNKRTLGRTAASGGEAGAKSAQPMWDDFMKSIL
EGVPVKTMKPPKGVISVSIDSRTGKLGSSRREYFIEGTEPKEHAVQEVGTTISTEGGANQ
ELF
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaaatattttttcatttttgttatctgttgcatttttttgggaaccgcc
tcgatttttggcatgtacaaatatgtcgaaggtgagttgcccgatgttgcgacaatgaaa
gacatccgtttgcaagtaccgatgcaggtattcagcgccgataatgagttgatcgcgcaa
tatggtgaaaaacgccgtatcccgttgccattaaatgaaattccacctttgatggtgaaa
gcatttatcgcaacagaggatagccgtttctacgatcatcatggtattgaccctattggt
atttttcgtgcagtcactgtcatggcatcatcaggccacgcctcacaaggggcgagtaca
atcacacaacaacttgcaagaaacttttatttaagccctgaaaaaacactgatgcgtaaa
gctaaagaggcttttcttgctatacgtattgagcagctatttactaaagatgaaattatg
gagctttacttaaataagatttatttaggtaaccgagcttatggtgttggtgcagcggct
tatgtttattttggaaaaacagccagtgaattaacactaagtgaaatggcgatgattgca
gggctaccaaaggcaccatcaacatttaatccgctttattcttatgaacgagctgttaac
cgccgtaatgtggttttgatgcgaatgttagaagaaaaatacattacgcaagaccagtac
gagcaagcgcgaaatgagaaaatagaagcctcttatcatgcacctaaagttgatttttcg
gctccttacttggccgaaatggcgcgtcaaactttgtatgataaatatggtgaagatgcc
tacactgacgggtataaaatttatacaacggtgatccgtaaagatcagttggcagcgact
gaggctgttcgcaataacctgatcgattatgatgtaagacatggttatcgcggcccgact
gaagtgttatggaaaccatcagaagcggcatggccggctgaaaaaatcgttgaaaaactg
aaaaaatcacctgtttatggccctttaatgcctgcagtagtgctttctacgacaaataat
gacgctaaggtgttattagctgatggaactgaagcacagatcacaatggcgggtgtacgc
tgggctcgcaagtatatttcagatacgcagcaaggcgctacgccaagaacagttaattct
gttgtgcaagcgggtgagcaaatttgggttcgccaagtaaaagataatttatggcttgca
caggttcctgacgttaatgccgcatttgttgctttaaatccgaatgatggtgccattatc
gcgctagtcggcggctttgattttaatatgagtgagtttaaccgtgttacgcaatcactg
cgtcaagtcggttcgaacatcaaaccctttttatataccgctgcgatggataaaggcctg
acgctttcatcattacttaacgatgtgcctattagtcgttgggatgctggggctggctca
gattggcgccctaaaaattcaccacctagatatgacggtccaattcgtttaagacaagga
ttaggtcagtcaaaaaacgttgtcatggtacgcgcaatgagggctatgggcgttgattat
gcggctgattatctcactcgttttggtttcccagcagaaaatattaatcgcacagaggca
ctcgctttgggcgcaccatcatttacaccaatgcaaatggtgcgtggttatgctgttatg
gttaacggcgggtaccttgttgacccttattatattttgaaaattgaaaatcatgatgat
gaagtgatttttgaggcgaaacccaaaatagcctgtccagattgtactcatattccagtc
gtttacggtgataccgaacgcagtattactgttgaaggcgttgatgatgcatcaaccgag
gaagtcacgcagtcaggtagcggcgttgctgtacaggaaccgacaatggaacttgccaca
gcttcagagcaaggggcaaattctggcgatatgtatgcacctcatgttattggtacgccg
ctagcattcctcatcagggatgcaatgatgaccaatatttacggtgaacccggttggtca
ggaacgggttggcgagcggctcgtgatttgggtggccgacgtgatattggcggtaaaacg
ggaacgaccaatagctcaaaagatgcttggttctccggttatggccctgatgtggtagct
tcggcttggataggttttgatgacaataaacgtactttaggtcgaacagccgcaagcggt
ggtgaagcaggggcaaagagtgctcagccaatgtgggatgattttatgaaatcaatcctt
gaaggcgttcctgtcaaaacaatgaagccaccaaaaggtgtgatttccgtttctatcgac
agtcgaaccggtaaattaggttcttctcgacgtgaatactttattgaaggaaccgaaccg
aaagagcatgcggtacaagaagttggaacaacgatttccactgaaggtggggcaaaccaa
gagttgttttaa

DBGET integrated database retrieval system