KEGG   Providencia heimbachae: NCTC12003_01307Help
Entry
NCTC12003_01307   CDS       T05509                                 

Gene name
mip
Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase Mip precursor
Organism
phei  Providencia heimbachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TSC22 SlyX FKBP_C
Motif
Other DBs
NCBI-ProteinID: SQH12611
LinkDB All DBs
Position
1:1486018..1490667
Genome map
AA seq 1549 aa AA seqDB search
MRTNLRLCVSLALFTTFFSHVPKADSFNNVIDDFDAYLQLEKEGKLQEQQQPQPPVNTQA
QGYEIFSSLSTVPAPKERSKSAAAPKRANSKTTGKSKTGLSVTANENANGNAGKGQPVEP
EKTTFSEVCTLTEGKYPSQSALSSSFPYLFQSDQWNPRYLAKDFAKYQVVLDPLGLYSSK
FINKPVVDSAVYLAQLVELIEHQRLTNLYQFGLAQGVGQLIAYNQLLTDDQLVAKLINHN
KSIAELSHIITEKQFEINKLTDEVELNKDQIAQLQSQLSSTEDKSIIDDLNRKLTAAEKT
IEQRQNSLTELSQENQQTQEIVAQLEKQLNESIVEQSKIKQQLAEKDKQFADASLQVDQL
TAEITKLELAAKEQLLRSGDTDEQVKLVTADLLKNQELLKQKEDELALTQKQKNEIQIAL
KEQQDTAKQLDAQNIQLTAQLAEKAQQADKIQAALTAQTAKAEQKAALEAELAAAKQQLQ
AHQTAQDTLSKQYADSQKQQQQLQTALTQNEQNYAAAQKQLAQAHVDLQKLQKDVEKQTA
LMSQASDQQVKALTDDLNKQLALLKQKEEGLKHAEANSQTTREALAKQQADAKALAEKNQ
QLTAQLAEKAQQADKIQAALAAQTAKAEQKAALEAELAAAKQQLQAHQTAQDTLSKQYAD
SQKQQQQLQTALAQNEQNYAAAQKQLAQAHVDLQKLQKDVEKQTALMSQASDQQVKALTD
DLNKQLALLKQKEEGLKHAEVNSQTTREALAKQQADAKALAEKNQQLTAQLAEKAQQADK
IQAALAAQTAKAEQKAVLEAELAAAKQQLQAHQTAQDTLSKQYADSQKQQQQLQTALAQN
EQNYAAAQKQLAQANVDLQKLQKDVEKQTALMSQASDQQVKALTDDLNKQLALLKQKEEG
LKHAEVNSQTTREALAKQQADAKALAEKNQQLTAQLAEKAQQADKIQAALAAQTAKAEQK
AALEAELAAAKQQLQAHQTAQDTLSKQYADSQKQQQQLQTALAQNEQNYAAAQKQLAQAH
VDLQKLQKDVEKQTALMSQASDQQVKALTDDLNKQLALLKQKEEGLKHAEVNSQTTREAL
AKQQADAKALAEKNQQLTAQLAEKAQQADKIQAALAAQTAKAEQKAALEAELAAAKQQLQ
AHQTAQNTLSKQFVDSQKQQQQLQTALAQNEQNYAAAQKQLAQANVDLQKLQKDVEKQTA
LMSQASDTQVKTLTNDLTKQMALLKQKETALSKLDAEKKMIQESLAAQKSDKQLLELKNT
QLAKQAEEQEKILSNLKKDIAIQTKKQSEVEQQLAEANKQISALKLNTEKLTVVSTNFQT
QALELENLKKQLNDKINAESKTQKDLALAQDNLKKLKAELESKPALQNDNALKSQIMDLN
KTIARLQQENESLKSKPASSNKGLAGRVNPKAPSAQDLKQIANENSKRNEKIIEQITQQK
YSKLDSNTYYKVLQAGSPITNVKNKDITFIMREQLTDGTVTVMYTDKNPVTLPYNELPTP
LNSFIEKAGEGGMVKVYIKPEGGYGVQGIPGEVPPNSMSIIDLKIIKAK
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgagaactaacctaaggctttgtgtgtcgctggcactttttacgacattttttagtcac
gttccaaaagcggatagctttaataacgttattgatgattttgatgcttacctacagctc
gaaaaagaaggtaagttacaagagcaacagcaaccgcaaccgccagtgaatacacaagct
caaggttatgaaattttttcttcactatctacagttcctgcgccaaaagaaagaagtaaa
tctgcggcagcaccaaaaagagctaatagcaaaacaacagggaagagcaagactggttta
tcagttactgcgaatgaaaatgcaaacggtaatgcgggtaaagggcagccagtagagcct
gaaaaaacaacgttctcggaagtttgtacattgactgaggggaaatatccctctcaatca
gcgctatcatcttcattcccctatttatttcaaagcgatcaatggaaccctcgatattta
gcgaaggattttgcaaagtatcaggtagttcttgacccgctcggtttatattcttcaaaa
tttattaataagcctgtagtagatagtgctgtttatctagctcaattagtcgagttaatt
gaacatcagagattaacaaatttatatcaatttggccttgctcaaggtgttgggcagcta
attgcatataatcaattgttaacagatgatcaactcgtagcaaagcttattaatcataat
aagagtattgctgagttaagccatattattactgaaaagcaatttgaaattaataagctc
acggatgaggttgaactcaataaagatcaaatcgcacaattacaatctcagttatcttca
acagaagacaagtcaattattgatgatcttaatcgtaaacttacagccgctgaaaaaacg
atagaacaaagacaaaatagccttacggaacttagccaagaaaaccaacaaacacaggaa
atagttgctcagcttgaaaagcaattaaatgaaagtattgttgagcaatcgaaaattaag
caacagctagctgaaaaagataaacaatttgcagatgcgagtttgcaggttgatcaactg
acggcagagatcactaaattagagttagcagccaaagagcaattattgcgaagtggtgac
acggatgaacaagttaagttagtcacagctgacctattgaagaatcaagaattattaaag
caaaaagaagatgaattagcattaacacaaaagcaaaaaaatgaaattcaaattgcatta
aaagaacaacaagatacggctaagcagttagacgctcaaaatattcagctaaccgcgcag
ttagccgaaaaagcccagcaagcggataaaatacaagcggcgttgacggcgcaaaccgca
aaagctgagcaaaaagccgctttagaagccgagttagcggcagcgaagcaacaattacaa
gcccatcaaacggcgcaagatacgttgtcaaaacagtatgccgatagccaaaaacagcaa
caacagctgcaaacggcattaacgcagaacgaacaaaactacgcggcggcgcaaaaacag
ttggcacaagctcatgtggatttgcagaaattgcaaaaagacgtggaaaaacagacggcg
ttgatgagccaagccagcgaccagcaagtgaaagcgttgacagacgatctgaacaaacaa
ctggccttgctgaagcaaaaagaagagggtctaaaacacgcggaagccaacagtcaaacc
acccgtgaggctttagcgaaacagcaagcggatgcgaaagcattagccgagaaaaatcag
cagctaaccgcgcagttagccgaaaaagcccagcaagcagataaaattcaagcggcgtta
gcggcgcaaaccgcaaaagctgagcaaaaagccgctttagaagccgagttagcggccgcg
aagcaacagttacaagcccatcaaacggcgcaagatacgctgtcaaaacagtatgccgat
agccaaaaacagcaacaacagctgcaaacggcattagcgcagaacgaacaaaattacgcg
gcggcgcaaaaacagttggcgcaagctcatgtggatttgcagaaattgcaaaaagacgtg
gaaaaacagacggcgttgatgagccaagccagcgaccagcaagtgaaagcgttgacagac
gatctgaacaaacaactggccttgctgaagcaaaaagaagagggcctaaaacacgcggaa
gtcaacagccaaaccacccgtgaggctttagcgaaacagcaagcggatgcgaaagcatta
gccgagaaaaatcagcagctaaccgcgcagttagccgaaaaagcccagcaagcagataaa
attcaagcggctttagcggcgcaaaccgcaaaagctgagcaaaaagccgttttagaagcc
gagttagcggccgcgaagcaacaattacaagcccatcaaacggcgcaagatacgctgtca
aaacagtatgcggatagccaaaaacagcaacaacagctgcaaacggcattagcgcagaac
gaacaaaattacgcggcggcgcaaaaacagttggcgcaagccaatgtagatttgcagaaa
ttgcaaaaagacgtggaaaaacagacggcgttgatgagccaagccagcgaccagcaagtg
aaagcgttgacagacgatctgaacaaacaactggccttgctgaagcaaaaagaagagggt
ctaaaacacgcggaagtcaacagtcaaaccacccgtgaggctttagcgaaacagcaagcg
gatgcgaaagcattagccgagaaaaatcagcagctaaccgcgcagttagccgaaaaagcc
cagcaagcggataaaattcaagcggctttagcggcacaaaccgcaaaagctgagcaaaaa
gctgctttagaagccgagttagcggccgcgaagcaacaattacaagcccatcaaacggcg
caagatacgctgtcaaaacagtatgcggatagtcaaaaacagcaacaacagctgcaaacg
gcattagcgcagaacgaacaaaattatgcggcggcgcaaaaacagttggcgcaagctcat
gtggatttgcagaaattgcaaaaagacgtggaaaaacagacggcgttgatgagccaagcc
agcgaccagcaagtgaaagcgttgaccgacgatctgaacaaacaactggccttgctgaag
caaaaagaagagggactaaaacacgcggaagtcaacagccaaaccacccgtgaggcttta
gcgaaacagcaagcggatgcgaaagcattagccgagaaaaatcagcagctaaccgcgcag
ttagccgaaaaagcccagcaagcggataaaattcaagcggcgttagcggcacaaaccgca
aaagctgagcaaaaagctgctttagaagccgagttagcggccgcgaagcagcaattacaa
gcccatcaaacagcacaaaatacgctgtcaaaacagtttgtcgatagtcaaaaacagcaa
caacagctgcaaacggcattagcgcagaacgaacaaaattatgcggcggcgcaaaaacag
ttggcgcaagccaatgtagatttgcagaaattgcaaaaagacgtggaaaaacagacggcg
ttgatgagccaagccagcgatacacaagttaaaacgttaactaatgatctaacaaagcaa
atggcgctgctcaaacaaaaagaaactgcattatctaagttagacgcagagaaaaaaatg
attcaagagtcgttagctgctcagaaatctgataagcaactactggagttaaaaaatact
cagttagctaagcaagcggaagagcaggaaaaaatcttatctaaccttaaaaaagatatt
gcaatacaaacgaaaaaacagtctgaagttgaacaacaattggctgaggcaaataaacaa
attagcgcgttaaaactcaatacggagaagctgaccgtagtgagcactaattttcagact
caagccttagagcttgaaaatttgaaaaaacagctgaatgataaaattaacgcggaatca
aaaacgcaaaaagatctggcattagcgcaagataatttgaaaaaattgaaggctgaatta
gagtctaagcccgctttgcagaatgataatgcactaaaatctcaaattatggatttgaat
aaaaccatagcgcggcttcagcaggaaaatgaaagcttaaaatctaaaccagcgagttct
aataaaggtttagccggccgagttaatccaaaagcaccttcagcacaagatttaaaacaa
attgctaatgaaaatagtaagcgcaatgaaaaaattatcgagcaaattacgcaacaaaaa
tacagtaagcttgatagcaatacctactataaagtcttacaagcgggctcaccaattaca
aatgtgaaaaataaagatatcacctttattatgagggagcagttaacagatggtaccgta
actgtaatgtacacggataaaaacccagtcacattaccttataatgaattaccgacacca
cttaattcattcattgaaaaagccggtgagggggggatggttaaagtctatattaaacca
gaaggtggttatggtgttcaggggatccctggagaagtgcctccaaactcaatgtctatt
attgatttgaaaataattaaagcaaagtaa

DBGET integrated database retrieval system