KEGG   Providencia heimbachae: NCTC12003_01506Help
Entry
NCTC12003_01506   CDS       T05509                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
phei  Providencia heimbachae
Pathway
phei00071  Fatty acid degradation
phei00280  Valine, leucine and isoleucine degradation
phei00281  Geraniol degradation
phei00310  Lysine degradation
phei00362  Benzoate degradation
phei00380  Tryptophan metabolism
phei00410  beta-Alanine metabolism
phei00640  Propanoate metabolism
phei00650  Butanoate metabolism
phei00903  Limonene and pinene degradation
phei00930  Caprolactam degradation
phei01100  Metabolic pathways
phei01110  Biosynthesis of secondary metabolites
phei01120  Microbial metabolism in diverse environments
phei01130  Biosynthesis of antibiotics
phei01200  Carbon metabolism
phei01212  Fatty acid metabolism
Module
phei_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCTC12003_01506 (fadJ)
   00650 Butanoate metabolism
    NCTC12003_01506 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCTC12003_01506 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCTC12003_01506 (fadJ)
   00310 Lysine degradation
    NCTC12003_01506 (fadJ)
   00380 Tryptophan metabolism
    NCTC12003_01506 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCTC12003_01506 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCTC12003_01506 (fadJ)
   00281 Geraniol degradation
    NCTC12003_01506 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCTC12003_01506 (fadJ)
   00930 Caprolactam degradation
    NCTC12003_01506 (fadJ)
Enzymes [BR:phei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NCTC12003_01506 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCTC12003_01506 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NCTC12003_01506 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: SQH12798
LinkDB All DBs
Position
1:1709460..1711634
Genome map
AA seq 724 aa AA seqDB search
MEQHSTTEVKTDITEPAFTLEIYDENVGVIFIDVPNEKVNTLKAEFAEQFLAILHKAQST
SGLKGLVITSGKKDNFIAGADISMIANCETKAQASELSTEGHALFDKIDNYPLPIIAAIH
GACLGGGLELALACHARVCSSDDKTRLGLPEVQIGLLPGSGGTQRLPRLVGIPHALDLML
TGRQLKAKQAQKIGLVDDVVPTTILLDVAIKMVKKGGVHRPAIHWQQRLLSSKFLRNQVF
KSAKQKALSKTKGHYPAPEKIIQVVKIGMNKGLKAGYAEEAKAFGELVMTPESAALRSLF
FASTALKNEAGAQATPLKIKQIGVLGGGLMGGGIAYVSASQGKLPVRIKDISDKGVTQAL
RYSWDLLTQRVLKRRLLSRERSAIMSRISGTLSYQGLDKSDVVIEAVFEDLALKQKMVAE
VEKMSAGSAIFASNTSSLPIHQIAAESTHPEKVIGLHYFSPVDKMPLVEVIPHEHTDAKT
IATVVALAKRQGKTAIVVGDDAGFYVNRILAPYLCEAAECLVQGEPIEHIDNALVNFGFP
VGPFNLLDEVGIDVGTKILPILVERFGNRFKAPEALDKVVKDDRKGKKNGRGFYEYGHSS
SRLIFWKKSSKRQVDKRIYSLINIHVESKQSKTEIAQRCVMLMLNEAARCLDEKIIRSAR
DGDIGAVFGIGFPPFFGGPFRYMDSLGIAKTVETMKMLSERYGDKFQPCDLLCHMAENNT
NFYQ
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacattctactacagaggtaaaaacggatatcactgaacctgcgtttacactc
gaaatttatgatgaaaatgtgggtgtgatttttattgatgtgccgaacgaaaaagtaaac
accttaaaagcggagtttgcagaacaatttttagccattttacacaaggcacaatcgaca
tctgggttaaaaggcttagttatcacatcgggtaaaaaagacaattttatcgccggtgct
gacattagcatgattgcaaattgtgaaacaaaagcacaagccagcgagctttcaacagaa
ggccatgcgctatttgataaaatagataattatcctttaccgattattgctgcaattcac
ggtgcatgcttagggggtggcttagagcttgcgctggcttgccatgcaagggtgtgttca
agtgatgataaaacacggttagggctgccagaagtgcagattgggctgttacccggttcc
ggtggtacgcagcgactacctcgcttagtgggtatccctcatgcactagacttaatgctc
acagggcgacagctaaaagcgaagcaagcacaaaaaatcggcttagtggatgatgttgtc
cctacgactattttattagatgtcgcaataaaaatggtaaaaaaaggtggcgttcatcgt
cctgcaatccattggcagcagcgtttacttagcagtaagtttttacgtaatcaagtattt
aaaagtgctaaacaaaaagcattaagcaaaacaaaagggcattatccggcgccggaaaaa
attattcaggttgttaaaataggcatgaataaaggtctcaaagctggctatgcagaagaa
gcaaaagcgtttggtgaattagtgatgacacctgagtcggcagcgctgcgtagcttattt
tttgcgtcaacagcattaaaaaatgaggcaggcgcacaagcaacaccattaaaaataaaa
cagataggtgtactcggtggcggtttaatgggcggtggaattgcttatgtcagtgcttct
caaggtaaattacctgttcgtatcaaggatatttcagataaaggtgtaactcaggcattg
cgttatagctgggatttgcttactcaacgagtattaaaaagacgtttattgtctcgtgag
cgttcagcaattatgtctagaatttctgggacgttaagttaccaagggcttgataaatcg
gatgtcgttattgaagctgtctttgaagatttagcattgaaacaaaaaatggttgctgaa
gttgaaaaaatgtcagcggggagcgctatttttgcatcaaatacatcgtctttacctatt
catcaaatagccgctgagtcgactcatcctgaaaaggtaattggtctacattattttagt
cctgtcgataaaatgccattggtggaagtgatcccgcatgagcatactgacgcaaaaact
atcgcaactgttgtcgctttggctaagcgccaaggaaaaactgccattgtcgttggtgat
gatgccggcttttatgttaaccgaatattagcgccttatttatgtgaagcggctgaatgc
cttgtacaaggtgagccgattgaacatatcgataacgcattggtcaattttggttttcct
gttggcccatttaatctactcgacgaagtgggcatcgatgtgggaactaaaattttgcct
attcttgtcgagcgttttggtaatcgatttaaagcgcctgaagcactagataaagtggtt
aaggatgatagaaaaggaaagaaaaatggtagaggattttatgaatatggccactcatct
tcccgtttaatattttggaaaaaatcatcaaaacgtcaagttgataaacgtatctattca
ttaattaatattcacgttgagagtaaacaaagcaaaacggaaattgctcaacgctgcgtc
atgttaatgctcaatgaagcggcgcgttgtctggatgaaaaaattattcgtagtgctcgg
gatggggatattggcgctgtatttggcattggcttcccaccattctttgggggaccattc
cgctatatggatagcttagggattgcgaaaaccgttgagacgatgaaaatgctatcagag
cgttatggtgacaaatttcagccttgcgatttgttatgtcatatggctgaaaataataca
aacttctatcaataa

DBGET integrated database retrieval system