KEGG   Providencia heimbachae: NCTC12003_01534Help
Entry
NCTC12003_01534   CDS       T05509                                 

Gene name
accD
Definition
(GenBank) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
phei  Providencia heimbachae
Pathway
phei00061  Fatty acid biosynthesis
phei00620  Pyruvate metabolism
phei00640  Propanoate metabolism
phei01100  Metabolic pathways
phei01110  Biosynthesis of secondary metabolites
phei01120  Microbial metabolism in diverse environments
phei01130  Biosynthesis of antibiotics
phei01200  Carbon metabolism
phei01212  Fatty acid metabolism
Module
phei_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC12003_01534 (accD)
   00640 Propanoate metabolism
    NCTC12003_01534 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC12003_01534 (accD)
Enzymes [BR:phei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NCTC12003_01534 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NCTC12003_01534 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DZR OrfB_Zn_ribbon Zn-ribbon_8 FYDLN_acid
Motif
Other DBs
NCBI-ProteinID: SQH12826
LinkDB All DBs
Position
1:1746338..1747318
Genome map
AA seq 326 aa AA seqDB search
MSWIEKILKKGNLTQSHKANIPEGVWKKCDSCGQVLYGAELERNLEVCPKCDHHMRIHAR
QRLETFLDEDSTTELGSELEPKDILKFRDSKKYKDRISAAQKETGEKDAIIVMKGTLKGM
PVVAAAFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSSSGGARMQEALLSLMQMA
KTSAALAKMQERGLPYISVLTDPTMGGVSASLAMLGDINVAEPKALIGFAGPRVIEQTVR
EKLPAGFQRSEFLLEKGAIDMIVRRPEMRDRLAKILAMLTNKPSFDTETIIIVEDDQVDI
GIVDDIESIDANSQEKDSAKLKKDDE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaaaaaattttaaagaaaggtaacttaacccaatcacataaagccaat
attcctgaaggtgtttggaaaaaatgtgatagttgtgggcaagtcctgtacggagctgaa
cttgagcgtaatttggaagtgtgtcctaaatgtgaccaccatatgcgtattcatgcacgt
caacgtcttgaaacttttcttgatgaagactcaacaaccgaattaggtagcgaacttgag
ccaaaagatattctcaagtttcgtgattcaaaaaaatataaagaccgtatttccgctgca
cagaaagaaacgggcgagaaagacgccattatcgtcatgaaaggcacactaaagggaatg
cccgttgttgctgcggcatttgagtttgctttcatgggcggttcaatggcttctgttgtg
ggagcccgttttgttcgtgcagttgaacaagcattggaagataactgcccattagtgtgt
ttctcttcgagcggcggtgcacggatgcaagaagccttgttatcattgatgcaaatggca
aaaaccagtgcagcacttgctaaaatgcaagagcgtggtttaccgtacatttcagtgctg
acagatccaaccatgggcggtgtttctgctagccttgccatgttaggtgatattaacgtt
gctgagcctaaagcgttaatcggttttgccggtccgcgcgttatcgagcaaactgtacgt
gaaaaattacctgcaggtttccaacgcagtgagtttttactggaaaaaggggcaattgat
atgattgttcgtcgtccagaaatgcgtgacagacttgccaaaattttagcaatgctaacc
aacaaaccaagttttgacacagaaacgattattattgttgaagatgaccaagtagacatt
ggtattgttgatgacattgaaagcatcgatgcaaatagccaagaaaaggattctgctaag
cttaaaaaagatgatgagtaa

DBGET integrated database retrieval system