KEGG   Providencia heimbachae: NCTC12003_01837Help
Entry
NCTC12003_01837   CDS       T05509                                 

Gene name
alr_2
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
phei  Providencia heimbachae
Pathway
phei00473  D-Alanine metabolism
phei01100  Metabolic pathways
phei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC12003_01837 (alr_2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCTC12003_01837 (alr_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
    NCTC12003_01837 (alr_2)
Enzymes [BR:phei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NCTC12003_01837 (alr_2)
Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
 Precursor biosynthesis
  Racemase
   NCTC12003_01837 (alr_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Spherulin4
Motif
Other DBs
NCBI-ProteinID: SQH13120
LinkDB All DBs
Position
1:2065540..2066763
Genome map
AA seq 407 aa AA seqDB search
MAFRLRYLALLPLLVATACQQPVNTNTIATPSAQVQPAIVNNSWIEISRSALDYNVKKVQ
ALLGDKSSLCAVLKGDAYGHDLSLVTPVMIENNVQCIGLTSNTEFKTVRDLGFKERLMRV
RNATEKEMAQATEFNVEELIGNLDMAQRLNAIAEKQNKIIPIHLALNSAGMSRNGLEVGN
AAGLNDAKLISELPNLKIVGIMSHYPEEDEAQIRKDLAKFNKQSKQVIDITGLKREEVTL
HVANTYATITVPESWLDMVRVGGIFYGDTVATNDYKRVMTFKSNIAAVNHYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNTGHALINGQKVPVLGKTSMNTVMVDVTDLKKV
QPGDEVVFFGKQGMQEISAEEVEYISGALFTEMSILWGATNQRVLVD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttcgtttgagatatcttgcattactcccattacttgttgcaacagcttgtcag
caaccagtaaataccaacaccattgcgacaccaagtgcgcaagttcaacccgctattgtc
aataattcatggatagagatttctcgaagtgcgctcgattataacgttaaaaaggtacag
gcattgttaggggataaatcgtccctgtgtgcggtgttaaaaggggatgcctatgggcat
gatctctcattagttacacccgttatgatcgaaaataatgtgcaatgtattggactgacc
agtaataccgagttcaaaacggttagagatcttggttttaaagaacgtttgatgcgggta
cgtaatgcgactgaaaaagaaatggcgcaagcaaccgaatttaatgttgaagagttgatc
ggtaatttagatatggcgcagcgcttgaatgccattgctgaaaaacaaaataaaattatt
ccaattcatttagcgttgaattcagcgggaatgtcccgcaatggtctagaagtggggaat
gcagcggggctcaatgacgctaaattgatttctgaactgcctaatctgaaaattgttggc
atcatgtctcactatcctgaagaagatgaagcccaaattagaaaagatttggcgaaattt
aataagcaatcaaagcaagtcattgatatcacaggtttgaaacgtgaagaggtgacactg
catgttgccaatacttacgctacgattacggttcccgaatcctggctggatatggtgcgt
gtcggcggtattttttacggtgatacggttgcgacaaatgactataagcgagtgatgaca
tttaaatctaatattgcagcagtgaatcattatccaaaaggtaatactgtgggatatgac
cgaacctatactttgaaacgcgactcagtattggcaaatattcctgttggttatgcagat
ggttaccgtcgagtgtttagtaatacaggacacgcattaattaacggtcagaaagtgcct
gtattaggaaaaacctcaatgaatacggtaatggttgatgtaacggatttaaaaaaggtt
cagccaggtgatgaagttgttttctttggtaaacaaggaatgcaagaaataagcgctgaa
gaagtggaatatatcagtggggcactatttactgaaatgtcaatcttgtggggcgcgacc
aatcagcgtgtacttgtcgattaa

DBGET integrated database retrieval system