KEGG   Providencia heimbachae: NCTC12003_01919Help
Entry
NCTC12003_01919   CDS       T05509                                 

Gene name
trpG_2
Definition
(GenBank) Anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
phei  Providencia heimbachae
Pathway
phei00400  Phenylalanine, tyrosine and tryptophan biosynthesis
phei01100  Metabolic pathways
phei01110  Biosynthesis of secondary metabolites
phei01130  Biosynthesis of antibiotics
phei01230  Biosynthesis of amino acids
phei02024  Quorum sensing
Module
phei_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCTC12003_01919 (trpG_2)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    NCTC12003_01919 (trpG_2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCTC12003_01919 (trpG_2)
Enzymes [BR:phei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     NCTC12003_01919 (trpG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: SQH13199
LinkDB All DBs
Position
1:complement(2151265..2151876)
Genome map
AA seq 203 aa AA seqDB search
MANILLLDNVDSFTYNLVDQLRSGGHQVVIYRNTVAAEHILSVLNKMESPILVLSPGPGK
PSEAGSMPEVLKQVKGKIPVIGICLGHQAIVEAYGGTVSAAGEILHGKSSMATHDELAMF
TGLENPLSVARYHSLVGSLIPDTLTLCAQSNGMVMAVRNDQERVCGFQFHPESILTTQGK
MLLENTVAWALSTPNKNTTKHSQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctaatattttactgctcgataatgttgattcctttacctataaccttgttgaccaa
cttcgctcaggggggcatcaggttgtgatttaccgtaatacggttgcggcagaacacatt
ttgtcagtactaaataaaatggaatcacctattttggttttatctccaggccctgggaaa
cccagtgaagctggctcaatgcctgaagtactcaagcaagtcaaaggcaaaattccggtt
atcggtatttgcttaggtcaccaggctattgttgaagcctatggtggcacggtatcagcc
gcgggggaaatattacacggtaaatcttccatggcgactcatgatgaacttgccatgttt
actgggcttgaaaatccactttccgttgcacgttaccactctctggttggcagcctaatc
ccagacacattaacgctctgcgcccaatctaatggcatggttatggcggttcgtaatgat
caggaacgtgtttgtggttttcaatttcatcctgaatcgattttaaccactcagggcaaa
atgttgttagaaaataccgtggcgtgggctctttctacacccaataaaaacacaactaaa
cattcgcaataa

DBGET integrated database retrieval system