KEGG   Providencia heimbachae: NCTC12003_02993Help
Entry
NCTC12003_02993   CDS       T05509                                 

Gene name
ftsI_2
Definition
(GenBank) Peptidoglycan synthase FtsI precursor
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
phei  Providencia heimbachae
Pathway
phei00550  Peptidoglycan biosynthesis
phei01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC12003_02993 (ftsI_2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NCTC12003_02993 (ftsI_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
    NCTC12003_02993 (ftsI_2)
Enzymes [BR:phei01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NCTC12003_02993 (ftsI_2)
Peptidoglycan biosynthesis and degradation proteins [BR:phei01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NCTC12003_02993 (ftsI_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: SQH14265
LinkDB All DBs
Position
1:3268177..3270066
Genome map
AA seq 629 aa AA seqDB search
MKTQRTPFRDHTAESVLFIRRALIAFGIIVILTALLITNLYHLQIVRHEDYQTRSNDNRI
KLVPIAPSRGIIYDRKGTQLALNSTFYQLEIVPEKVENLPETLEKLRDVVGLTDEDITNF
EKERKRSRRFTSIALKTRLDEVQVARFAVNQYRFPGLEVKSYQRRSYPYGSALTHVIGYV
AKINDKDVERLDKEGLLPNYAASHDIGKLGIERYYEDVLHGKTGYEEVEVNSRGRVIRQL
HEQPPQAGRDIYLTIDLELQIYIEKLLTTSRAAVVVTDPRNGEILALVSNPSYDSNLFVN
GISNKDYQALLNNPDRPLINRTTQGLYPPASTVKPFISVAALSEKVITPNTTIFDPGWWQ
LPGSEKRYRDWKRWGHGKLNVMKSIIESADTFFYQVAYDMGIDRLSAWMTRFGFGEYTGI
DISEERSGIMPTREWKQKRYKKPWYQGDTIPVGIGQGYWTATPIQMSKALMTLINDGQVK
TPHLLYGTKLGNAMVPYEDTETKQIGDIHSGYWELAKQGMYGVANAPNGTGRRSFVGTPY
KAAAKSGTAQVFSYETYNASKLAEHLRDHKLMIAYAPYDKPTIAVAIILENGGAGPTVGD
LVRQIFDHVLLGDNSTQVESSLAGTEEDR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaacgcaccccttttcgcgaccatactgctgagtcagtgttatttatacgc
cgagcacttattgctttcggcatcatcgtcattttgactgccctactcatcactaatttg
tatcacttgcagattgtgcgtcatgaagattaccaaacacgctcaaatgataaccgaatt
aaactcgttcctatcgcgccgagccgcggtattatttatgaccgaaaaggaacgcaactc
gcactcaacagcacgttctatcaactcgaaatcgtccctgaaaaagttgaaaacctgcca
gaaacactagaaaaactgcgagatgttgtcggtcttaccgatgaagacattactaatttt
gaaaaagagcggaagcgttcgcgtcgctttacctctattgcgctaaaaacacgcttagat
gaagttcaagtcgctcgctttgctgtgaatcaataccgcttcccagggcttgaagttaaa
agctatcaacgtcgttcatacccttatggttccgcattaacccacgttatcggctatgtc
gcaaaaattaatgataaagacgtcgaacggcttgataaagaagggttattacctaattac
gctgctagccatgatattggtaaactcggtatcgaacgctattacgaagatgttcttcat
ggtaaaacaggctatgaagaagttgaagtcaatagccgaggccgtgttattcgccaactt
catgaacaacctccacaagcaggtcgcgatatttatttaacgatagatcttgagctacaa
atttatattgagaagctactaacaaccagccgtgctgccgttgtcgttaccgatcctcgt
aatggtgaaattttagcgttagtttctaatccaagttatgactcaaatctattcgtgaat
gggatttccaataaagattatcaagcactactcaataatcctgatagaccactcattaac
agaactacgcaagggctatatccaccagcctcaacggttaagccttttatttcagtcgcc
gcactcagtgaaaaagtcataacaccaaataccactatttttgatcccggttggtggcaa
cttcccggttcagaaaaacgttaccgagactggaagcgctggggacatggcaaactgaat
gtgatgaagtcgattattgaatcagcggataccttcttttaccaagttgcttatgatatg
gggattgatcgcctttccgcatggatgacccgctttggttttggcgaatataccgggatt
gacatttcagaagagcgttcagggattatgccaacccgtgaatggaaacaaaaacgctat
aaaaaaccttggtatcaaggggatacgatccctgttggtattggccaaggctattggact
gcaacgccgattcaaatgtcaaaagccttgatgacactcattaatgacgggcaagtcaaa
acacctcatttgctttacggaaccaaactgggtaatgccatggtcccttatgaagatacc
gaaactaaacagattggcgatatccattcaggttattgggagctagcaaaacaaggtatg
tatggcgttgcaaatgcaccgaatggaacgggccgacgcagcttcgtgggtacaccttat
aaagcggccgcaaaatcaggtaccgcacaagtatttagttatgaaacctataacgcaagc
aaacttgcagaacatttgcgtgaccataagctgatgattgcctacgcaccttatgataaa
ccgaccattgcagtggctatcattcttgaaaatggtggcgcaggtccaacagtcggcgac
ttagttcgccaaatcttcgatcatgtccttttaggcgataatagtacgcaggtagaaagc
tcacttgccggtactgaggaagaccgttaa

DBGET integrated database retrieval system