KEGG   Providencia heimbachae: NCTC12003_03174
Entry
NCTC12003_03174   CDS       T05509                                 

Gene name
tdh_2
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
phei  Providencia heimbachae
Pathway
phei00052  Galactose metabolism
phei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCTC12003_03174 (tdh_2)
Enzymes [BR:phei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     NCTC12003_03174 (tdh_2)
SSDB
Motif
Pfam: ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_N TrkA_N 2-Hacid_dh_C Methyltransf_25 ELFV_dehydrog CoA_binding Pyr_redox UDPG_MGDP_dh_N Shikimate_DH 3HCDH_N PrmA ThiF
Other DBs
NCBI-ProteinID: SQH14577
LinkDB
Position
1:complement(3469699..3470526)
AA seq 275 aa
MTVNIGDKICCVPLIPNFETEESKRGYYSLGKGYSFIGSRQPGGNAEYVVMPESSCFILP
DDITEIEGAFFEPVTVGIHPILMAGGCKDKNVVIVGVGTIGMLAMQSAKALGAKTVTAID
ISDEKLALAKELGADYVINSSKEKENQEIEFLEIIKFDQLILETAGVPQTFKLSLELAGP
RAQLALVGTLHKDLLLGYKEYEQILRKELTIIGSWMNYSKPFPGDEWEVTINLFRNKKIV
INPLIEEVVNSDKYIKKVIGLNGYPANGKILLKWD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacggttaatataggagataagatatgttgtgtgcctttaattcctaattttgaaaca
gaagaaagcaagcgtggttattattctttaggtaaagggtattcctttatcggatcgcgc
cagccaggtggtaatgcagagtatgttgttatgccggaaagtagttgttttatattacca
gatgatattactgaaattgaaggtgcattttttgagcccgtcactgttgggattcatccg
atactaatggctggcggttgtaaggataaaaatgtcgttattgtaggagtaggcactatt
ggtatgttagcaatgcagagtgctaaagctttaggcgcaaagacggtaaccgcaattgat
attagtgatgaaaaattagcattagctaaagagcttggcgctgattatgttataaatagt
tctaaagagaaagagaaccaagaaattgaatttttagaaattattaaatttgatcagcta
attttagaaacggcaggagtccctcaaacatttaaattatctttagaacttgcaggtcct
agagcacaacttgccttagttggaacattacataaggatttattattaggttataaagaa
tatgaacaaatattacgtaaagaattaacaattattggaagttggatgaactattcaaag
ccatttcctggggatgaatgggaagtaacaataaatttatttagaaataaaaaaatcgtc
attaatcctctgattgaagaagttgttaattcagataaatatataaaaaaggtcattggc
ctaaatggttacccagctaatgggaaaatccttctgaaatgggactga

DBGET integrated database retrieval system