KEGG   Providencia heimbachae: NCTC12003_03835Help
Entry
NCTC12003_03835   CDS       T05509                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
phei  Providencia heimbachae
Pathway
phei00250  Alanine, aspartate and glutamate metabolism
phei00410  beta-Alanine metabolism
phei00430  Taurine and hypotaurine metabolism
phei00650  Butanoate metabolism
phei01100  Metabolic pathways
phei01110  Biosynthesis of secondary metabolites
phei01120  Microbial metabolism in diverse environments
phei02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCTC12003_03835 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCTC12003_03835 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCTC12003_03835 (gadB)
   00430 Taurine and hypotaurine metabolism
    NCTC12003_03835 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCTC12003_03835 (gadB)
Enzymes [BR:phei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NCTC12003_03835 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: SQH15733
LinkDB All DBs
Position
1:4138897..4140297
Genome map
AA seq 466 aa AA seqDB search
MSKKSLTPNYSELDDVYASFDLSQSLPKTQFPLKERDPRNVYSAVRDELMLDGNSRQNLA
TFCQTWVDDEIRELMDLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDAENTLGCST
IGSSEAAMLGGLALKWQWRKKQAAKGKPTDKPNLICGPVQVCWHKFARYFDVELREIPLE
GDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQKETGLDIPIHVD
GASGGFLAPFCAPDLPWDFRLPRVKSINSSGHKFGLAPLGAGWVIWREAKDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYATAQYLAREIEKLGPF
EMIFDGDSQKGIPAIAWKLKEGAASSNYSLYDIADKLRSRGWQVPAYSMPANREDLVVQR
ILVRHGVSLDLAALLIEDFKRTLDYFNEHPVSKPLTEKEGGGFNHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagtcattaacaccaaactacagtgaacttgatgatgtatatgcatcattt
gatttatcgcaatcattacctaaaactcagtttccattgaaagaacgagatccacgtaat
gtatatagtgcagttcgtgatgaattaatgcttgatggcaactcaaggcaaaacttagcg
acattttgtcaaacttgggttgatgatgaaattcgtgaattaatggatttgtctatcgat
aaaaatatgatcgataaagatgaatacccacaaacggctgaaattgagaatcgctgcgtt
catatgcttgccgacctttggcattctccggatgcggaaaatacactcggttgctcaaca
attggctcatcagaagccgccatgttaggtggactagccttaaaatggcaatggcgtaaa
aaacaagcagcaaaaggtaaaccaacagataaaccaaaccttatttgtggtcccgttcaa
gtttgctggcacaaatttgcacgctacttcgatgttgaactcagagagattccccttgaa
ggggatcgtttaatcatgagtccagaagaagtactcaaacgcgttgatgaaaataccatt
ggtgttgtacctactttaggcgtcacattcacttgccaatatgagccggttaaagccgtg
catgatgcattggataaactgcaaaaagaaactggactcgatattcctatccatgtggat
ggcgcgagtggcggtttccttgcacccttctgcgcacctgatttgccatgggatttccgt
ttaccacgtgttaaatcaatcaactcttctggtcataaattcggtttagcacctttaggt
gccggctgggtaatttggcgtgaagcaaaagatttaccggaagaactaattttcaatgtg
aattatttaggtggcaatatgccaactttcgcactgaatttctcacgtccgggcggtcaa
atcattgcgcaatactataacttcctgcgtcttggtcgcgaaggttatgcaaaaattcat
aatgcgtgttacgccacggcacaataccttgcgcgtgaaattgaaaagctcggtcctttc
gaaatgatttttgatggtgatagtcaaaaagggatcccagctatcgcatggaaactaaaa
gaaggcgcagcttccagtaattattctttatacgatattgctgacaagttacgcagtcgt
ggctggcaggtaccggcttattcaatgcctgctaatcgtgaagaccttgttgttcagcgt
attctcgttcgtcatggggtcagcttagatctcgccgcactattaattgaagattttaaa
cgtactttagattacttcaatgaacatccagtcagtaagcccctaactgaaaaagaaggt
ggtggtttcaaccacagctaa

DBGET integrated database retrieval system