KEGG   Pseudonocardia sp. HH130630-07: AFB00_01550Help
Entry
AFB00_01550       CDS       T04486                                 

Definition
(GenBank) glutamine-synthetase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
phh  Pseudonocardia sp. HH130630-07
Brite
KEGG Orthology (KO) [BR:phh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFB00_01550
Enzymes [BR:phh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     AFB00_01550
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     AFB00_01550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C
Motif
Other DBs
NCBI-ProteinID: ANY05212
UniProt: A0A1B1ZHJ1
LinkDB All DBs
Position
complement(312850..315885)
Genome map
AA seq 1011 aa AA seqDB search
MDRRAGTSLARLGLTGPDTDATLRGLGWWSGEAPAAGCEEIMWALARSPDQVLALRAVER
LAQTPPWPDIDAALRTDSGLRGRLFATLGSSTALGDHLVAHPDSWTLLADTPDRRDPAPD
LARRTANLLRAVGADPDAPTPGAPGGARATVTGAAAVTALRTAYRDELLGLASADLAAVG
DPALPVMEVDDVAAQLADLAEAALRAALAVAVAEQEPPEELRLAVIGMGKCGGRELNYVS
DVDVVFVAEPGGELTQAATKLASRVMRVAGEACFEVDANLRPEGRQGALVRTLDGHVTYY
RRWAKTWEFQALLKARPMAGDPELGAAYTGALAPMVWEASTRDDFVAEVQAMRTRVIENI
PSDQRERELKLGRGGLRDVEFAVQLLQLVHGRNDDTLRSGNTLQALAELSAGGYVGRDDG
ANLAASYRFLRLLEHRLQLQKLRRTHLLPAADDTDALRWLARAARIRPDGRRDVVGVLVA
EWQRNARRVSRLHEKLFYRPLLSAVSRIAGEEADAVLSPDAAKARLSALGWASADGALGH
LRALTGGVSRAASIQRALLPVLLDELSHAPDPDRGLLAYRRVSEALAATPWYLRLLRDEG
AVAQRLMTLLGTSALVPDLLARAPEVLRMLATSSEVQSPELTRDPAEVSVALRATVARQT
TPEAAVASARSYRRHEMLRIACADLLGLIEIDAVCAALNSVNEAVIAATLDAVLRAEPEP
LAALAVIGMGRLGGGESSYGSDADVMFVCAPAEGVEDHAAVKWATRVVEKLRRLLGAPSP
DPALPVDADLRPEGRSGPMVRTLTSYRGYYARWSEVWETQALLRARPIAGDRALGREFTA
LIDPIRYPGDGLSAASVAEIRRIKARVDDERLPRGADRTTHTKLGHGGLADVEWTVQLLQ
LQHAGDLPELRTTSTLDGLHEAAEAGLVSGSDALELEQGWRSATSARNAIMLVKGKPGDQ
LPRSGRELAAVAAALGYPAGGDSGEFLDDYRRTARRARQVVERVFYGWTED
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgcgcgggaacctcgctggcccggctgggactcaccggaccggacacggac
gcgaccctgcggggactcgggtggtggagcggcgaggccccggccgccgggtgcgaggag
atcatgtgggccctcgcccgcagccccgaccaggtcctggcgttgcgcgcggtcgagcgg
ctcgcccagacgccgccctggcccgacatcgacgccgccctgcgcaccgactccgggctg
cgcgggcggttgttcgccaccctcggctcctccacggcgctcggtgaccacctggtcgcc
cacccggacagctggacgctgctcgccgacaccccggaccggcgcgacccggccccggac
ctcgcgcgccgcaccgcgaacctgctgcgcgcggtcggtgccgaccccgacgcccccacc
cccggcgcccccggtggtgcccgggcgacggtgaccggggcggcggcggtcacggccctg
cgcaccgcctaccgcgacgaactgctcggcctcgcctcggcggacctggccgcagtgggg
gacccggcgctgccggtgatggaggtcgacgacgtcgccgcccagctcgccgacctcgcc
gaggcggcgctgcgggccgcgctggcggtcgccgtcgccgagcaggaaccgcccgaggag
ctgcgcctcgccgtcatcggcatgggcaagtgcggcggccgggagctgaactacgtctcc
gacgtcgacgtcgtcttcgtggccgagcccggcggggagctgacccaggccgcgacgaag
ctcgcctcccgggtcatgcgggtggccggcgaggcctgtttcgaggtcgacgcgaacctc
cggccggaggggcgccagggggccctggtccggaccctggacgggcacgtcacctactac
cggcggtgggcgaagacctgggagttccaggccctgctcaaggcccgcccgatggcgggg
gaccccgagctgggcgcggcctacaccggcgcgctggcgcccatggtgtgggaggcctcc
acccgggacgacttcgtcgccgaggtgcaggcgatgcgcacccgggtgatcgagaacatc
ccctccgaccagcgggaacgggagctcaagctgggccggggcgggctgcgcgacgtcgag
ttcgccgtccagctcctgcagctcgtgcacggccgcaacgacgacaccctgcgttccggc
aacaccctgcaggcgctcgcggaactgtccgcgggcggctacgtgggccgggacgacggc
gcgaacctggccgcgtcctaccgcttcctgcggttgctggagcaccggctgcagctgcag
aagctgcgccgcacccacctgctcccggccgccgacgacaccgacgcgctgcgctggctg
gcccgcgcggcgcggatccggccggacggtcgtcgcgacgtcgtcggggtactggtcgcc
gagtggcagcgcaacgcgcgccgggtgagccggttgcacgagaagctgttctaccggccg
ctgctgtccgcggtgtcccggattgcgggggaggaggccgacgccgtcctgtccccggac
gcggcgaaggcccggctctcggcgctgggctgggcgtccgccgacggcgcgctcggtcac
ctgcgggcgctcaccggcggggtctcgcgggcggcgtcgatccagcgcgcactgctcccg
gtgctgctcgatgagctgtcgcacgcccccgacccggaccgcggcctgctcgcctaccgg
cgggtctccgaggctctggccgcgacgccctggtacctgcggctgctgcgcgacgagggc
gccgtcgcccagcgcttgatgacgctgctcggtacctccgcgctggtgccggacctcctg
gcgcgggcgccggaggtcctgcggatgctggcgacgtcgtcggaggtgcagagcccggag
ctcacccgggacccggccgaggtctcggtggcgctgcgggcgaccgtcgcccggcagacg
acgcccgaggccgccgtcgcgtccgcgcgctcctaccggcggcacgagatgctgcgcatc
gcctgcgccgacctgctcggcctgatcgagatcgacgccgtctgcgccgcgctgaactcg
gtgaacgaggcggtcatcgccgcgaccctggacgcggtgctgcgggccgagccggagccg
ctcgccgcgctggcggtgatcgggatgggccggctcggcggcggggagtccagctacggc
agcgacgccgacgtcatgttcgtctgcgcgccggccgagggcgtcgaggaccacgccgcc
gtgaagtgggcgacccgggtcgtcgagaagctgcgccggctgctcggcgcacccagcccg
gacccggccctgccggtcgacgccgacctgcgaccggagggccggtccgggccgatggtg
cggacgctgacctcctaccggggctactacgcccgctggagcgaggtctgggagacccag
gcactgctgcgggcccggccgatcgccggggaccgggcgctgggccgggagttcaccgcg
ctgatcgacccgatccggtacccgggcgacgggctgtcggccgcctcggtggccgagatc
cggcggatcaaggcccgggtcgacgacgagcggctcccgcgcggtgcggaccgcaccacc
cacaccaagctgggccacggtggtctcgccgacgtcgagtggaccgtgcagctgctgcag
ctgcagcacgcgggtgacctgcccgagctgcggaccacctcgaccctcgacggcctgcac
gaggccgccgaggccgggctggtcagcgggtccgacgccctggagctggagcagggctgg
cggtccgccaccagcgcgcggaacgcgatcatgctggtcaagggcaaaccgggcgaccag
ctcccgcgctcggggcgggagctggccgcggtggccgccgcgctcgggtatccggccggc
ggcgactccggtgagttcctcgacgactaccggcgcaccgcgcggcgcgcccggcaggtc
gtcgagcgggtgttctacggctggaccgaggactga

DBGET integrated database retrieval system