KEGG   Pseudonocardia sp. HH130630-07: AFB00_04310
Entry
AFB00_04310       CDS       T04486                                 

Definition
(GenBank) phosphonomutase
Organism
phh  Pseudonocardia sp. HH130630-07
SSDB
Motif
Pfam: PEP_mutase Pantoate_transf
Other DBs
NCBI-ProteinID: ANY05654
UniProt: A0A1B1ZIU5
LinkDB
Position
876393..877172
AA seq 259 aa
MTSTADKATRLQELHAAPELLLVVNVWDAITAKVVAETPGTTALATASHGIAAAHGYEDG
ENIPRDEMIAAVGLIAHTAGDLPVSADLEAGYGDPGGTVARAIDVGIVGANLEDQAKPLA
ESVKAVEAAVAAAGSAGVDFVLNARTDVFLKAGDKDPDAVLADAIERGRAYLGAGASTFF
VPGKLDETQVGRLVEALGERTVNLIGIPGSIPLKTAQELGVARVSYGPWSQNVALTALAK
LAEDVYDGGGLPADTRKLN
NT seq 780 nt   +upstreamnt  +downstreamnt
atgacctcgaccgccgacaaggccacccggctgcaggagctgcacgccgctccggaactg
ctcctcgtcgtcaacgtgtgggacgcgatcaccgcgaaggtggtcgccgagacccccggg
acgaccgcgctcgccaccgccagccacggcatcgccgccgcgcacggctacgaggacggg
gagaacatcccgcgcgacgagatgatcgccgcggtcggcctcatcgcgcacaccgccggt
gacctgccggtgagcgcggacctggaggccggctacggcgacccgggcggcaccgtcgcc
cgcgcgatcgacgtcggcatcgtcggggcgaacctggaggaccaggccaagccgctcgcg
gagtcggtgaaggcggtcgaggcggccgtcgcggcggcggggtccgccggcgtcgacttc
gtgctcaacgcgcgcaccgacgtgttcctcaaggccggcgacaaggaccccgacgccgtg
ctggccgacgcgatcgagcgcggccgggcctacctcggcgccggggcgtcgaccttcttc
gtgcccggcaagctcgacgagacccaggtcgggcgcctcgtcgaggcgctgggcgagcgc
acggtcaacctgatcggcatccccggctcgatcccgctgaagaccgcgcaggagctgggc
gtcgcccgggtgtcctacggcccctggagccagaacgtcgcgctcaccgcgctggcgaag
ctcgccgaggacgtctacgacggcggtggcctccccgccgacacccgcaagctgaactga

DBGET integrated database retrieval system