KEGG   Pseudonocardia sp. HH130630-07: AFB00_04315Help
Entry
AFB00_04315       CDS       T04486                                 

Definition
(GenBank) 2-methyl-1,2 propanediol dehydrogenase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
phh  Pseudonocardia sp. HH130630-07
Brite
KEGG Orthology (KO) [BR:phh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFB00_04315
Enzymes [BR:phh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     AFB00_04315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 GMC_oxred_N FAD_binding_3 Pyr_redox_2 DAO Lycopene_cycl Thi4 NAD_binding_8 FAD_oxidored Peptidase_S37 Pyr_redox_3 GIDA 3HCDH_N HI0933_like Pyr_redox MIP
Motif
Other DBs
NCBI-ProteinID: ANY05655
UniProt: A0A1B1ZIT3
LinkDB All DBs
Position
complement(877265..878917)
Genome map
AA seq 550 aa AA seqDB search
MPAYTETDVLVIGAGPGGAGIALKLARAGVKVVCLEQGPWVTPQEHPHYHDEWELEKQRG
WAYDPNVRQLPEDYPVTGVTTPYMMNNVGGSTVHYAGHWPRYKPVDFRKGTEHGLEGTID
WPISYEDLAPFYDENDEIYGVSGRIGDPSYPDRKQAVRDPEVLPGKLGLKYAKASRDLGW
HWWPSDNAIITRDRENRHADQAMGNELSGSPTGSLSTPANAHWPYAIRHGADLRTMARVE
RINASNGRATGATYIDRNTGDRHEVRAKIVVLAANGIGSPRLLLQSAQAGHPDGLANSNG
IVGKYLMHHVFAFCDSWFDEPVEGYKGSFGAPLYSHEFYHTDVSRGFVNGFGMQVARSFG
PAYAAMGTHTGYTAPWGARHREFFDGHFANHLMVFMFGEDLPVETNRVTLDHDVTDSSGL
PAAHVDYELHANDIALAKYGIDKIFEATRAVGAVETNDTGVLYPPPAWHLMGTCRMGNHP
GDSVLNKWCQTWDVPNLFVCDGSTLTTGGAVNPTSTIGALAQRTGEYILRNYDALVAQRT
TPSNADAPTM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatacaccgagacggacgtcctggtcatcggggccgggcccggcggggccggg
atcgcgctgaagctggccagggccggtgtgaaggtggtctgcctggaacagggcccgtgg
gtcacgccccaggagcacccgcactaccacgacgagtgggagctggagaagcagcgcggc
tgggcctacgaccccaacgtgcgtcagctgcccgaggactacccggtcaccggggtcacg
acgccgtacatgatgaacaacgtcggcggctcgaccgtgcactacgccggtcactggccg
cgctacaagccggtcgacttccgcaagggcaccgagcacgggctcgaggggacgatcgac
tggccgatcagctacgaggacctcgccccgttctacgacgagaacgacgagatctacggc
gtctccggccggatcggtgacccgtcctacccggaccgcaagcaagccgtccgcgacccg
gaggtactgcccggcaagctcgggctcaagtacgccaaggcgtcgcgcgacctgggctgg
cactggtggccgtcggacaacgcgatcatcacccgggaccgggagaaccgccacgccgac
caggcgatgggcaacgagctgtcgggcagcccgaccggctcgctgtccaccccggcgaac
gcgcactggccctacgccatccggcacggcgcggacctgcgcacgatggcccgcgtcgaa
cggatcaacgcctcgaacggccgggccaccggcgcgacctacatcgaccggaacaccggc
gaccggcacgaggtgcgggcgaagatcgtggtgctcgcggccaacggcatcgggtcaccg
cggctgctgctgcagagcgcgcaggccgggcacccggacgggctggcgaactccaacggg
atcgtcggcaagtacctgatgcaccacgtcttcgcgttctgcgactcgtggttcgacgag
cccgtcgagggctacaagggcagcttcggggcgccgctgtacagccacgagttctaccac
accgacgtgagcaggggattcgtcaacggcttcggcatgcaggtcgcgcgcagcttcggg
ccggcctacgccgcgatgggcacgcacaccggctacaccgcgccgtggggcgcgcggcac
cgcgagttcttcgacgggcacttcgccaaccacctgatggtcttcatgttcggcgaggac
ctgccggtggagacgaacagggtgacgctggaccacgacgtcaccgacagctcgggcctg
ccggccgcacacgtggactacgagctgcacgccaacgacatcgcgctcgcgaagtacggg
atcgacaagatcttcgaggccacccgggcggtcggggcggtcgagaccaacgacaccggg
gtgctctacccgccgccggcctggcacctgatgggcacctgccggatgggcaaccacccg
ggcgactcggtgctcaacaagtggtgccagacctgggacgtgccgaacctgttcgtctgc
gacggcagcacgctgaccaccggcggcgcggtcaacccgacgagcaccatcggcgcactg
gcccagcgcaccggcgagtacatcctgcgcaactacgacgcactggtggcacagcggacc
accccgtccaacgccgacgcgccgaccatgtga

DBGET integrated database retrieval system