KEGG   Pseudonocardia sp. HH130630-07: AFB00_07785Help
Entry
AFB00_07785       CDS       T04486                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00040  Pentose and glucuronate interconversions
phh00051  Fructose and mannose metabolism
phh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFB00_07785
   00051 Fructose and mannose metabolism
    AFB00_07785
Enzymes [BR:phh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AFB00_07785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANY09885
UniProt: A0A1B1ZW08
LinkDB All DBs
Position
1618085..1619110
Genome map
AA seq 341 aa AA seqDB search
MTASVEIPESMRCSVLRAAGELEVQERAVPRPGPREVLVRVASVGTCGSDVHYFTHGRIG
GFVVREPLVLGHEPAGRIVAVGAGVDTGRIGQRVSVEPGVPCRRCRYCHTGAYNLCPDVV
FFATPPVDGAFAEYVTIADDFAHPVPDHVSDDAAALLEPLSVALWAHHRAGTGVGARVLV
AGAGPIGLLVAQVAAVQGAAEVLVSDPDPGRRAMASDFGATATFDPADGGSDGPADVDAF
VDCSGAPRAVLAGLDAVRPGGNAVLVGMGADEMTLPVSVLQSREISLTGTFRYAGTWPTA
VRLAASGAVDLDRLVTSHVDLDHVGDALAPDPSQVKVVVRP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgagcgtcgagatccccgagtcgatgcggtgcagcgtgctgcgcgccgccggt
gaactggaggtgcaggagcgggcggtgccccgccccgggccgcgggaggtgctggtccgg
gtggcctcggtcggcacctgcggctccgacgtgcactacttcacccacggccggatcggc
gggttcgtcgtgcgcgagccgctggtgctcgggcacgagccggccgggcggatcgtcgcc
gtcggcgccggggtggacaccgggcggatcgggcagcgggtctcggtcgaacccggcgtc
ccgtgccggcgctgccgctactgccacaccggtgcctacaacctctgcccggacgtcgtg
ttcttcgcgacgccgccggtcgacggtgcgttcgccgagtacgtcacgatcgccgacgac
ttcgcccacccggtccccgaccacgtctccgacgacgccgcggccctgctcgaaccgctg
tcggtggcgctgtgggcgcaccaccgggccgggaccggggtgggtgcccgggtgctggtc
gccggggccggtccgatcgggttgctggtcgcgcaggtcgccgcggtgcagggggccgcc
gaggtgctggtgagcgacccggacccgggccgccgggcgatggcgtcggacttcggcgcc
accgcgacgttcgacccggccgacggcgggtccgacggcccggccgacgtcgacgcgttc
gtcgactgctccggggcgccccgggccgtgctcgccgggctggacgcggtccgccccggc
ggcaacgccgtgctggtcggcatgggcgccgacgagatgacgctgccggtgtccgtgctg
cagtcccgcgagatctcgctgaccgggacgttccgctacgccggcacctggccgaccgcg
gtgcgcctcgccgcgtccggggcggtcgacctcgaccggctggtgacctcgcacgtcgat
ctcgaccacgtcggcgacgcgctggcgccggacccgtcccaggtgaaggtcgtggtccgt
ccgtga

DBGET integrated database retrieval system