KEGG   Pseudonocardia sp. HH130630-07: AFB00_09665Help
Entry
AFB00_09665       CDS       T04486                                 

Definition
(GenBank) amidase
Organism
phh  Pseudonocardia sp. HH130630-07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANY06513
UniProt: A0A1B1ZL76
LinkDB All DBs
Position
1998857..2000158
Genome map
AA seq 433 aa AA seqDB search
MLPLPELIRTLRSGELSPADHVDDVLSRLGGDETNSVVQLDAERARARAAELTTLSARGG
SAGPLHGVAVGIKDIIDVAGLPTRCGSAILRDAPPATADAPIVAMLRAAGAVVVGKLHTH
EFACGPTGDVSVTGPARNPHDLTRITGGSSSGSAATVAAGHLPLTVGTDTAASVRTPAAL
CGVAGLKPRRGALPGGGVFPLAESFDTVGLLTTDAAGLAVARAALGGPEAGDGTPGTGRL
RIGVATGDWWRPQDPVIGDAVRIAADALADLGHPVTGQETPDVAELVATYAEITGSEVYA
THRDWLATRRGEYQPATADRVSARGEAPAHAYLGARRERDRLAAAFLAGLDCDVLLCPTT
LLRATPLGDGPSEPGVQMAMLQATAPFNLTDRPVVALPVPVPGLPAGIQLVGITVGEAAV
LDLAGALEPVLRR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgctccccgaactgatccggaccctgcgctccggtgagctgtccccggccgac
cacgtcgacgacgtcctgtcccggctgggcggcgacgagaccaacagcgtcgtgcagctc
gacgcggaacgggcccgggcccgggccgcggagctgaccacgctgtcggcgcgcggcggg
agcgccgggccgctgcacggcgtcgcggtggggatcaaggacatcatcgacgtcgcgggg
ctgcccacccggtgcggctcggcgatcctgcgcgacgccccgcccgcgacggcggacgcg
ccgatcgtggcgatgctgcgggccgcgggggcggtcgtcgtcgggaagctgcacacccac
gagttcgcctgcgggccgaccggtgacgtctcggtgaccgggcccgcccgcaacccgcac
gacctgacccggatcacgggcggttcctcgtccgggtcggcggcgacggtcgccgccggg
cacctcccgctgaccgtcgggacggacaccgcggccagcgtccgcaccccggccgcgctg
tgcggggtcgcggggctcaagccgcggcgcggcgcgctgcccggcggcggggtgttcccg
ctggccgagtcgttcgacacggtcgggctcctcacgacggacgcggccgggctggcggtc
gcccgcgccgcgctgggcggcccggaggcgggcgacggcaccccgggcaccggccggctg
cggatcggcgtcgcgaccggcgactggtggcggccgcaggatccggtgatcggcgacgcc
gtccggatcgcggcggacgcactcgccgatctcgggcacccggtgaccgggcaggagacc
ccggacgtggcggagctcgtcgccacctacgcggagatcaccgggagcgaggtgtacgcg
acccatcgcgactggctcgccacccggcgcggggagtaccagccggcgaccgccgaccgg
gtgtccgcgcgcggcgaggcccccgcgcacgcctacctcggcgcccgccgcgagcgcgac
cggctcgccgccgcgttcctggccgggctcgactgcgacgtcctgctctgcccgaccacg
ctgctgcgggccaccccgctcggcgacggaccgtcggaaccgggcgtgcagatggcgatg
ctgcaggccacggcgccgttcaacctcaccgaccggcccgtggtggcgctcccggtcccg
gtgccggggctcccggccggcatccagctcgtcgggatcacggtcggcgaggccgcggtg
ctggacctggccggcgcgctggagccggtcctgcgccgctga

DBGET integrated database retrieval system