KEGG   Pseudonocardia sp. HH130630-07: AFB00_20670Help
Entry
AFB00_20670       CDS       T04486                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
phh  Pseudonocardia sp. HH130630-07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DUF3509
Motif
Other DBs
NCBI-ProteinID: ANY08285
UniProt: A0A1B1ZRF1
LinkDB All DBs
Position
complement(4353137..4354207)
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKPAPAIPDDRLYEPKWDGFRAIVFRDGDEVEIGSRNERPMTRYFPE
VVEAVRAHLPERSVVDGEIVVADRAQNRLDFEALQQRIHPAASRVTLLSTETPASFVAFD
LLALDDDDLTARPFAQRRELLESALADAGDPVHVTPITGDPAVARRWFERFEGAGLDGLI
AKDPAGTYQPDKRVLTKIKHERTADCVLAGYRVHKSGPDAVGSLLLGLHDERGVLVSVGV
VGAFPMARRRELMTELAPLVTDFDDHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLR
PERVVEVRYDYMEGARFRHTTQFVRWRPDRTPESCTYAQLERPVSFDLGEVLAGRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaaaccgatgctggccaagccggcacccgcgatc
cccgacgaccggctctacgaacccaagtgggacggcttccgggcgatcgtgttccgcgac
ggcgacgaggtcgagatcggctcccgcaacgagcggccgatgacccgctacttccccgag
gtcgtcgaggcggtccgcgcccaccttccggagcggtcggtcgtcgacggcgagatcgtc
gtcgcggaccgggcgcagaaccggctcgacttcgaggcgctgcagcagcggatccatccc
gccgccagccgggtgacgctgctgtcgaccgagaccccggcctcgttcgtggcgttcgac
ctgctcgccctcgacgacgacgacctgaccgcgcgcccgttcgcgcagcgccgggagctg
ctggagtccgcgctcgccgacgcgggcgacccggtgcacgtcaccccgatcaccggcgac
ccggcggtggcccgccggtggttcgagcggttcgagggcgccggcctggacggcctcatc
gcgaaggacccggccgggacctaccagccggacaagcgcgtcctgaccaagatcaagcac
gagcgcaccgcggactgcgtgctcgccggctaccgggtgcacaagtccgggccggatgcc
gtcggctcgctgctgctcggcctgcacgacgagcgcggggtgctggtctcggtcggcgtg
gtcggggcgttcccgatggcgcgccgtcgcgagctcatgacggagctggccccgctggtc
accgacttcgacgaccacccgtgggcctgggcgaagcagctcgagggcgagcgcaccccg
cgcaagtccgagaccagccgctggaacgccggcaaggacctgtcgttcgtcccgctgcgc
ccggagcgggtcgtggaggtgcgctacgactacatggagggcgcccggttccggcacacc
acccagttcgtgcgctggcgcccggaccgcacccccgagtcgtgcacctacgcccagctg
gaacgcccggtgagcttcgacctgggcgaggtgctcgcgggccgcggctga

DBGET integrated database retrieval system