KEGG   Pseudonocardia sp. HH130630-07: AFB00_22580Help
Entry
AFB00_22580       CDS       T04486                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00630  Glyoxylate and dicarboxylate metabolism
phh01100  Metabolic pathways
phh01110  Biosynthesis of secondary metabolites
phh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AFB00_22580
Enzymes [BR:phh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     AFB00_22580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ANY08591
UniProt: A0A1B1ZS46
LinkDB All DBs
Position
complement(4748174..4748821)
Genome map
AA seq 215 aa AA seqDB search
MLTHILLDLDGTLVDSAPGILGSLRRAIDEVGLDVPESALGTHLLGPPMYRSLPPILGEQ
GAADVVPVYRRIYGDEDGWLASTPYPGVEELLRELDEAGVTIALATSKAESSARKIVAHH
GWADLFTETVGDTPAGDRPTKGAVVGEALRRLGHPDGDAAPLMVGDRRYDVAGAAEHGLR
CAGAGWGYAEPGELEAAGAAVVHASADELRAAILG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgctcacccacatcctcctcgatctcgacggcaccctcgtcgactcggcccccgggatc
ctcggctcgctgcgccgggcgatcgacgaggtcgggctcgacgtgccggagtccgcgctg
ggtacccacctgctcggcccgccgatgtaccgctcgctgccgccgatcctcggcgagcag
ggggccgccgacgtcgtcccggtgtaccgccggatctacggcgacgaggacggctggctc
gcctcgaccccctatcccggggtcgaggagctgctgcgcgagctggacgaggcgggggtg
acgatcgcgctggccaccagcaaggccgagtcctcggcccgcaagatcgtggcccaccac
ggctgggccgacctgttcaccgagaccgtcggcgacaccccggccggcgaccggccgacc
aagggggccgtggtcggtgaggcactgcgccggctcgggcaccccgacggggacgcggca
ccgctgatggtgggcgaccgccgctacgacgtcgccggtgccgccgagcacgggctgcgg
tgtgccggcgcgggctggggttacgccgagccgggcgagctggaggccgcgggggccgcg
gtcgtgcacgcatccgcggacgaactccgggccgcgatcctcggctga

DBGET integrated database retrieval system