KEGG   Pseudonocardia sp. HH130630-07: AFB00_24310Help
Entry
AFB00_24310       CDS       T04486                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00473  D-Alanine metabolism
phh00550  Peptidoglycan biosynthesis
phh01100  Metabolic pathways
phh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:phh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFB00_24310
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFB00_24310
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AFB00_24310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phh01011]
    AFB00_24310
Enzymes [BR:phh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFB00_24310
Peptidoglycan biosynthesis and degradation proteins [BR:phh01011]
 Precursor biosynthesis
  Amino acid ligase
   AFB00_24310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ANY08865
UniProt: A0A1B1ZT53
LinkDB All DBs
Position
complement(5104158..5105174)
Genome map
AA seq 338 aa AA seqDB search
MLRVLHLAGSPVDEFFCDLSRLYAADCLEATADPARFTFHVAYVTPDGRWRFPSRLTPEA
IGAAPALTAGQAIRTVTGLGIDLMVPQMFCRPGMTHYRALFDLLQIPYVGNPPDVMALGA
DKARTRAVVADAGVAVPDGEVLRAGERPALAPPAVVKPVDADNSVGVSLVHDRAGYAEAL
AQAHRHGERALVETFVPLGREVRCAFVDTGDGPVCLPLEEYRMDAADKPIRLAADKLARD
DRGDLGLVAKDSRSWIVDLGDPVTAPVHEAALRAYRALGCRHYGLFDFRVDPGNRPWFVE
AGLYCSFARTSVVVTMAEAAGIPVDELFTSLATRALDG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgtgctgcacctcgccgggtcaccggtcgacgagttcttctgcgacctgtcc
cggctctacgccgccgactgcctggaggcgaccgccgatcccgcccggttcacgttccac
gtcgcgtacgtgaccccggacgggcgctggcggttcccgtcccggctgacacccgaggcg
atcggggccgctccggcgctcacggccgggcaggcgatccggaccgtcaccggtctcggt
atcgacctgatggtgccgcagatgttctgccggccgggcatgacgcactaccgggcgctg
ttcgacctgctgcagatcccctacgtgggcaacccgcccgacgtcatggcgctcggcgcg
gacaaggcacgtaccagggcggtcgtcgccgacgccggggtcgccgtgccggacggcgag
gtgctgcgcgccggtgagcggcccgcactggccccgcccgccgtggtgaaacccgtcgac
gccgacaactccgtcggggtgtccctggtgcacgaccgggccggctacgccgaggcgctg
gcgcaggcacaccggcacggcgagcgcgcgctggtcgagacgttcgtaccgctgggccgc
gaggtgcggtgcgccttcgtcgacaccggggacggcccggtctgcctcccgctggaggag
taccggatggacgccgcggacaagccgatccggctggccgcggacaagctcgcccgcgac
gaccgcggcgatctgggactggtcgcgaaggactcccggtcctggatcgtcgacctcggc
gacccggtcaccgcgccggtgcacgaggcggcgctgcgggcgtaccgggcgctggggtgc
cggcactacgggctgttcgacttccgggtggacccggggaaccggccgtggttcgtcgag
gccggcctgtactgctcgttcgcgcgcacctcggtggtcgtcaccatggcggaggccgcc
ggtatccccgtggacgagctcttcacctcgctcgccacgcgcgccctcgacgggtga

DBGET integrated database retrieval system