KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099139Help
Entry
102099139         CDS       T02921                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102099139 (MAPK6)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102099139 (MAPK6)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102099139 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 102099139
NCBI-ProteinID: XP_005521544
LinkDB All DBs
Position
Un
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HESTDVDKLNDLNSSVSQIELKGIISKSVSREKQEKGMANLAQLEALYQTSWDSQFVSGG
EGCFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKEREES
FLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggtggaaacggcttagttttttctgctgtcgataat
gactgtgacaaaagagtagctgtcaagaaaattgtccttacagatccccagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaagta
tttgaaattcttggtcccagtggaagccagttaacagatgatgtgggctccctgacagaa
ttgaactgtgtttacattgtccaggaatacatggagacagatctggctaatttgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaatgttctgcatagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagattggtgacttcggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttactaaatggtacagatcgccc
cggcttttgctttctcctaataactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagttgattctagaatcaattcctgttgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaacgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcactggacttcctggagcaaattctgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttatatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctaatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
caattttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctctctgatgttactgatgaagaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtacctggaggatcctgcctttgacacccacttctct
actgagccttgctggcagtactcagatcaccacgaaaacaagtattgtgatctggaatgt
agtcacacttgtaattacaaaatgaggtcatcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcaaactggaag
gaacaaagcaaagaaaagtctgacaagaaaggcaagtctaaatgtgaaaagaatgggttg
gtgaaagctcagatagcacttgaggaagcatcacagcaacttgttgaaaaagaaagggag
aagaatcaagggtttgactttgattcttttatagcagaaaccatccagcttagtttacaa
catgagtctactgatgttgataaattaaatgacttgaacagttcagtgtctcagatagag
ttgaaaggaataatatcgaagtcggtgagcagagagaagcaggagaagggaatggccaat
ttggcacagttagaagctctgtaccaaacttcttgggacagtcagtttgtcagtggtggg
gaggggtgcttcctcatagaccagttctgttgcgaagtaaggaaagatgaacaagttgaa
aaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagatgctgaa
atgctagaacctgagccagtagaagaggggaagcttggggagaaggaaagagaagagagc
tttctcagtaacagtggggaactcctcttcaacaagcagcttgaggctataggtattcct
cagtttcacagccctgttggttcgcctctcaagtccatccaggccacgctaacgccttct
gctatgaaatcatctccccagattccccacaaaacctacagcagcattctgaaacatcta
aactaa

DBGET integrated database retrieval system