KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099292Help
Entry
102099292         CDS       T02921                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00020  Citrate cycle (TCA cycle)
phi00620  Pyruvate metabolism
phi01100  Metabolic pathways
phi01200  Carbon metabolism
Module
phi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102099292 (DLAT)
   00020 Citrate cycle (TCA cycle)
    102099292 (DLAT)
   00620 Pyruvate metabolism
    102099292 (DLAT)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     102099292 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 102099292
NCBI-ProteinID: XP_005531173
LinkDB All DBs
Position
Un
AA seq 630 aa AA seqDB search
MWRVLARRVSRGAAGAPGLVRPRRALGTGVGAGAGPARRGPAWGGPAPRPLLPPPAWPRL
VPRRCCSLPAHQKVALPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESL
EECYLAKILVPEGTRDVPIGAIICITVEKPEHIDAFKNYTLDSAAAAAPTASVPPPPAAA
PSPPPQPSPQAPGSSYPPHMQVTLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDK
ATIGFEVQEEGYLAKILVPEGTRDVPLGSPLCIIVEKESDIPAFADYQAAAVTDMKAPAP
PPPPPPPPPVMATPAAAPPPPQPAAAPAPAAPTAGPPHKGGRVMVSPLAKKLAAEKGIDL
TQVKGTGPDGRITKKDVESFVPSKAAPAAAPGAVPAAAPEGTFTDIPISNIRRVIAQRLM
QSKQTIPHYYLSIDVDMGKVLVLRKELNQEVSDNIKLSVNDFIIKASALACLKVPEANSS
WLDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLAAISKDVASLAAKAREGKLQPHE
FQGGTFTISNLGMYGIKNFSAIINPPQACILAVGSSKERLVPADNEKGFDVASMMSVTLS
CDHRVVDGAVGAQWLAEFKNFLEKPVTMLL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggtgttggcgcgacgcgtgtcccggggcgcggccggggcgcccggcctggtg
cggccccgccgagcgctcgggaccggggtcggggccggggctggcccggcccggcgcggc
ccggcctggggcggccccgcgcctcgcccgctgctgccgccgcccgcctggccccggctc
gtcccgcgccgctgctgcagcctcccggcgcaccagaaggtggcactgccagcactgtcc
cccacgatgcagatgggcaccatcgcacgctgggagaagaaggagggggacaagatcaat
gaaggggatctcatagcagaggtggagacagacaaagctacagttggctttgagagcctg
gaggaatgttacctggccaagatcctggtgccagaaggaacaagggatgttcctattggg
gccataatatgtatcactgtagaaaagcctgaacatattgatgccttcaaaaattacacc
ctggattctgcagcagctgctgcccccacagcctcagtgcctccccctccagctgcagcc
ccctccccaccgcctcagccttctccacaggcccctggcagctcttaccctcctcacatg
caggtcactctccctgctctgtcacccaccatgacaatgggcacagtgcagaggtgggag
aagaaggttggggagaagctgaatgagggagacttactggccgaaattgagacagataaa
gccacaataggctttgaagtgcaggaggaaggctacctggcaaagatcttggtgcctgaa
ggaacaagagatgtgcccttaggatcccctctgtgcatcattgtggagaaggagtctgat
attccagcctttgccgactaccaggctgctgcagtcactgacatgaaggcaccagctcct
cctcctcctcctcctcctcctcctccggtgatggcaactcctgcagctgctcctcctcct
ccccagcctgctgctgctcctgctccagcagcccccacagcggggccaccccacaaagga
ggaagggtcatggtcagtcccctggcaaagaaattggcagcagagaaaggaattgacctt
acccaagtgaaaggtactggaccagacggcagaatcaccaaaaaagatgtggagtcattt
gtgccatcaaaggctgctccagctgcagctccgggggcagttcctgcagcagcacccgag
gggaccttcacagacatccccatcagcaacattcgcagggtcattgctcagaggctgatg
cagtccaaacaaacgatacctcactactacctgtccatcgatgtagacatgggaaaagtc
ttggtgctaaggaaagaactcaatcaggaggtctcagataacattaaactttctgtcaat
gatttcatcattaaagcttctgctttggcgtgcttgaaggtgcctgaggcaaattcttca
tggttggacacagttattaggcagaatcatgtggtggatgtgagtgtggctgtcagcacc
ccggcagggctcatcacccccatcgtcttcaacgctcacatcaagggcctggctgccatc
agcaaggacgtggcttccctggcagccaaagcccgggaagggaagctccagcctcacgaa
ttccagggtggtactttcacaatttccaatttaggaatgtatgggattaagaatttctct
gccataatcaatccacctcaagcctgcatcctggcagtggggtcctcaaaagaaagacta
gtgccagctgataatgagaaaggctttgatgtggccagcatgatgtctgtcaccctgagc
tgtgaccaccgtgttgtggatggagcagttggagcacagtggcttgctgagttcaagaat
ttccttgaaaagccagtaaccatgctgctataa

DBGET integrated database retrieval system