KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099335Help
Entry
102099335         CDS       T02921                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102099335 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102099335
NCBI-ProteinID: XP_005524775
LinkDB All DBs
Position
Un
AA seq 689 aa AA seqDB search
MAEDLVLETWDLQCDRNGQEHRTADMGCEQLVVRRGQPFTITLRFSGRGYEEGVDKLSFN
VETGPCPSETSGTSSHFVLTDCPEESCWSAVIQQQDGESLSVSLCSPPNARIGRYSMTLE
TCTDYQGSSYQIGDFVLLFNPWHPEDTVFLRDENERHEYVLSQHGLIYQGTCDYIFSIPW
NFGQFEDDILAICLNMLDINPKHLRDQNQDCSRRNDPVYIGRVVSAMVNCNDEDRGVLFG
RWDNSYEDGMSPMAWIGSVDILKRWKKFGCQPVKYGQCWVFAAVACTVMRCLGIPSRVVT
NYNSAHDTNANLTIDRYINEKGEQERYSWDKIWNFHCWVESWMARPDLAAGYDGWQVLDP
TPQEKSEGVYCCGPAPVKAIKEGDMLLKYDIPFIFAEVNADVVYWVVQGDGMQKQSIRSS
DVGKYISTKSVGRDSREDITHNYKYPEGSEEERAVFEKAEHQKKSIGEEDEGLHLRIKVS
EGANKGSDFDVFAVVNNNTDEEHVCRVTLCARVTSHNGTLGPQCGLTDPVDIDIEPRAEK
RVPLSILYEEYRDKLTQDNLIKVVALLKDHQTGDIIVAVRDIYVENPPIKIRILGEPMQN
RKLVAEISLVNPLTVPLNGCVFVVEGTGLTEGQLLKELEEPVEPQAEAKFRMDLMPRLSG
LQKLMVDFESDQLTGVKGYRNVIIAPQPM
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctggtgctggagacgtgggacctgcagtgtgaccgcaatgggcaggag
caccgcacggcggacatgggctgtgagcagctggtggtgcgccggggacagcccttcacc
atcaccctgcgcttctcgggccgcggctacgaggagggcgtggataaactctccttcaac
gtggagacggggccctgccccagtgagacatcaggaaccagctcccactttgtcctgact
gactgcccagaggaatcgtgctggagtgccgtgatccagcagcaggacggggagtccctg
tcagtctcactctgctccccacccaacgctcgcatcggccgctacagcatgaccctggag
acctgcactgactaccagggctccagctaccaaatcggggacttcgtcctgctcttcaac
ccctggcacccagaggacacggttttcttgcgtgacgagaatgagcggcacgagtacgtc
ctgtcccagcacgggcttatctaccagggcacctgcgattacatcttctccatcccctgg
aactttggccagttcgaggatgacatcttggccatctgcctcaacatgctggacataaac
cccaaacacctgcgggatcagaaccaggattgctcccgccgcaatgatcccgtgtacatt
ggcagggtggtgagcgccatggtaaactgtaatgatgaggaccgaggggtgctgtttggg
cggtgggacaacagctacgaggacgggatgagccccatggcctggattgggagtgtggat
attctcaagaggtggaagaagtttgggtgccagccagtcaagtatggccagtgctgggtc
tttgctgctgtggcttgcactgtcatgcggtgcctgggaatccccagccgggtggtgacc
aactacaactcagcccacgacacaaacgccaacctgaccatcgaccgctacatcaacgag
aagggggagcaggagaggtactcctgggacaagatctggaacttccactgctgggtggag
tcgtggatggcccgcccagacctggcagctggctatgatgggtggcaggtgctggacccg
acgcctcaggagaagagcgaaggagtttactgctgcgggccagcccccgtcaaagccatc
aaagagggcgacatgctgctcaagtacgacatccccttcatcttcgcggaggtgaacgcc
gacgtggtgtactgggtggtgcagggcgacgggatgcagaagcagagcatccgatcctca
gatgtggggaagtacatcagcaccaagagcgtaggcagggacagccgggaggacatcacc
cacaactacaaatacccggaggggtctgaggaggagcgggcagtgtttgagaaggcagag
catcagaagaagtccatcggggaggaggatgaggggctgcacctcaggatcaaggtgtca
gagggtgcaaacaagggcagcgacttcgatgtctttgccgttgtcaacaacaacacagac
gaggagcatgtctgcagggtgacgctgtgcgcccgtgtcaccagccacaacggcaccctc
gggccccagtgcggcctcacggacccagtcgacatcgacattgagcccagggcagagaag
agggtgcccctgagcatcctgtatgaagagtacagggacaaactgacccaggacaacctc
atcaaggtggtggctctcctgaaagatcaccagactggtgacatcattgttgctgtcagg
gacatttatgttgagaatccaccgatcaagatcaggattttaggagagccaatgcagaat
cggaagctggtggcagagatcagcctggtgaaccccctcacagtgcccctgaacggctgc
gtgttcgtggtggagggcaccggcctcaccgaggggcagttgctcaaggagcttgaggag
ccggtggagccgcaggcagaggccaaattccggatggacctgatgccgcggctgtcaggg
ctacagaagctgatggtggactttgagagcgaccagctgacaggggtcaagggctaccgc
aacgtcatcatcgcaccccagcccatgtga

DBGET integrated database retrieval system