KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099369Help
Entry
102099369         CDS       T02921                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi03440  Homologous recombination
phi04068  FoxO signaling pathway
phi04110  Cell cycle
phi04115  p53 signaling pathway
phi04210  Apoptosis
phi04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102099369 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102099369 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102099369 (ATM)
   04210 Apoptosis
    102099369 (ATM)
   04115 p53 signaling pathway
    102099369 (ATM)
   04218 Cellular senescence
    102099369 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102099369 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phi03032]
    102099369 (ATM)
   03400 DNA repair and recombination proteins [BR:phi03400]
    102099369 (ATM)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102099369 (ATM)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102099369 (ATM)
DNA replication proteins [BR:phi03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102099369 (ATM)
DNA repair and recombination proteins [BR:phi03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    102099369 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC LRAT
Motif
Other DBs
NCBI-GeneID: 102099369
NCBI-ProteinID: XP_014106925
LinkDB All DBs
Position
Un
AA seq 3067 aa AA seqDB search
MSLALHDLLICCRRLENEKAVERRKEIENLKRLLRDSETVLQLDRNSDSKQGKQLNWDAV
FSVLQKHFQKELKNLQLTKPNASASTQTTRQKKIQEVGSLVKYFIRCANKRGPRLKCQEL
LIYVMDIIRDPTSCAAYGSDCSSILLKDILSVRRYWCEISQQQWSELLTLYGHLYLKPSG
NINRVLVARIIHTLMRGYCFQTDGLCSDMLVFFSKAMQFARQEKNTAGLDHIVGAMNIFC
NKFADNCRIRICKVGEEILPTVLYIWTQYRPKDSLKESIIELFRLQVHIHHPKGAKTQGR
GAYDLTKWQSILHNLYDLLVNEINLISSRGKYSSGSRNVAVKENLIELMADICHQVFTED
TKVLEITQSYAVSQRGTSEDTVPNKRRRIELGWRVIQDNVQRSQKDFDVIPWLQITSQLV
SKYPMSLPNSELPALLSVLHQLLPQQRRGERTPYVLKCLTEIALCQNQKTDLKSTHKLEL
QRTWAKIWTLTIRSISLQQIEAESFGLLGAMIQGNLVVTDKELWKIFSGPACKPSSSAVC
CLSLVMSAYSVPENLDIGMEQNSSERNLGSVLREATMKWLLSSYLEEEIEECAELPPVLC
SDYPHLVLQKILVSLTMKNCRASMIFFQNDAKCEQHEQGKEENNFSDIEELYLQTTFDEM
DIFTSFAVNVADKNVTGLRLAINENLRETLENCLLAMSEKLLSSYGPKSKVVAAEHLVRC
VKLLVGVLGCYCYTGIFKEEDACKSALFQNAKSLMHYAGESISQSKNKLNEDTQINTLRT
LIMQCTKCLCNCTKNSANKMLSNIFLRLLTSKFMNDLIDICNNLMTVTGKPSVLGEVDLR
NDPEESIMEVDNRASDDLFDNHSVADISDTNESGDMQTVTGALSPLAEEQLTKQDLLLLE
IVRFLCICVTTVRVQTLSFRASDIRRRLLMLTEGSVFDSTKPLHLHMYLILLKELPTEEH
LLPAVDVDMLLKPLSAVCSLYRRDQEVCKVILNDLLPIAVGLAQFNEHAEEAGNAKGQFL
TVVGAFWHLSQGGKCTASVRVALLNCMKALLEVDPHCKWAILNVKNEDLPVSDAFPRFLA
DSHHQVRILAAKSITSLFQDVKQRDSSGMSRPLPLKLQQKAFENAYLRVQEGMSKLVRGD
GSPEDLLDKQSNGKAVLLMLITMVLCCSPVCEKQALFAICQSVKENGLEPELVKKVLKKV
SDIFGYKSIEDFMTSHLDYLVMEWLKMNDSGYSLSAFPYVLLNYTSLEEFYRSCYKVLVP
HLVIRSQFEDVKSLANKIDKDWREVLADCFPKLLVNILPYFAYQSHGKGEVAEQREMASK
VYDMLKDESCLGKQQMDSLSHSNLPEIVVELLMTLHEPAGTTVEEGSHLSKYIRELDPAP
NPPHFPSYVIKATLDYISSCHKSKLKSIVAVLSRSPDSFQKILLALCKHASDTKNMYKKH
RVLIIYHLFVGLLLKEIKDSLGGAWAFVLRDVIYTLIHHINSRPTIVRDISMRSFSLCCD
LLHHVCHTAVTCCSDALESHLHVIVGTLIPLAMGQSQIQEQVLCLLKYLVIDNKDNESLY
QAIKCLDPFPEYPAFQDLRATQQKIKYSKGPYSLLEEINHFLSVGVCDTLPLTRLEGLYD
LRKKLEQYKDQMKDLLKIFQEKPEDSVVVKLVVSLLQLSKIAVNHTGEKAVLEAVGSCLG
EIGPMDFSTTALQRAENALDSRAAELLEDRKLQCVFIMLVQINTALTDNCIGVRAAAVSC
LKNILATKSGNEFWEAYKSKADPMLIYLQPFRTSRKKLLVVSPSDAEAPLERLDDTNLWI
PLGESHETWIKHLTSSILDSGGVKNEVLQLMKPLCEVKTDLCQTLLPYLIHDILLHDSDE
SWRNLLSLHIQKFFTACCKFASSSRSTPNSDSSEQETHSFRSLDKVSRRAMLAVVDYLRR
QKRSVSGTVFDDSFWLDLNYLEVAIAAQSCAAHFTALLYAEIYADKINRDKEQERSSFKA
AKRLTFEEGSQRTPITTLNEKSKEETGISLQDHLLDIYRSIGEPDSLYGCGGGRMLQPLA
RIRTYEHEAVWGKALVTYDLETSLSPSTRQAGIIEALQNFGLCHTLSMYLKGLEHENTEW
CAELQEIRYQAAWRNMQWSHISSVKDEVGSQGYHESLYDALQSLRDKEFSAFHDSLKDAR
VNEVKELCKGSLESVYSLYPTLCRLQLIGELENAGLLFSRSVTTQQLKDVYLKWQRQSQL
LKDSDFHFQEPVMALRTVILEILLEKENENTKRECIKDLLTKHLVELSRLARTAKNTQLP
ERAMFQIKQHNPNGNGVSEWQLEEAQVFWAKKEESLGLNILKTMIKKLDADWFQVENDPH
LKLMYTECLRLCGTWLAETCLENPTVIMQKYLEKAVEIAASHSGDSSDELKKGKMKAFLS
LARFSDNQYQRIENYMKSSEFENKQALLKKAKEEVGLIRERRVQLNRYTVKVQRELELDE
GAIQALTEDRKRFLCKAVENYISCLLSGEEHDMWIFRLCSLWLENSGVDRVNEMMKKNAQ
KIPSYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLMSRISLDHPHHTLFIILALANANKD
ELLTKPDAIRRNKLIKNAPKEISQLDVDRMEAASTIMNIVRKRRAPMVRDIEALCDAYIT
LANLDSTPWKSQRKGISIPGDQPIIKLKNLEDVPVPTMEIKVDPTGQYENLVTISSFRQE
FRLAGGMNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQQNTETRKRK
LNIRRYKVVPLSQRSGVLEWCSGTTPIGEFLVNAEEGAHKRYRPKDYSSNQCHKIMLDAQ
KKHSDEKYRIFMEVCEHFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLG
DRHVQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRR
CCEKTMAVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADMSSTLGTDPQ
EPKRKASSDDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLF
PGWKPWV
NT seq 9204 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgcattacacgatctgctcatttgttgtcgtcgccttgaaaatgagaaagct
gtggagcgaaggaaagaaattgaaaatttaaagcgacttctccgtgattctgaaacagtt
ctccagctggaccgaaattctgattctaaacaaggaaagcaactcaactgggatgctgta
tttagtgtcttgcagaagcatttccagaaagaacttaaaaacttgcagctgacaaaacca
aatgcatctgcttcaacccaaactaccagacagaaaaagatacaagaagttggaagcttg
gtcaaatatttcatcagatgtgctaataaaagaggacccaggctgaaatgtcaggaactt
ctgatttatgtcatggatattataagagatccaacaagttgtgctgcttacggttctgac
tgtagtagtatactcctaaaggatatcctctcagtaaggagatactggtgtgagatatcc
cagcagcaatggtcagagttgctgaccctgtatggccatttatacctcaaaccatctggg
aacattaacagagtcttagtggctaggataattcacacacttatgagagggtactgcttc
caaactgatgggttgtgttctgacatgcttgtcttcttttcaaaagcaatgcagtttgca
aggcaagagaagaatactgcaggcctggatcatattgttggagcaatgaatatcttctgc
aacaagtttgctgacaactgtcgcatacggatttgcaaagtaggggaagaaattttgcct
acggtgctttacatatggactcaatatagaccaaaggattcactaaaagaatcaataatt
gagttatttcgtctccaagttcatattcatcatccaaagggtgcaaaaactcagggaaga
ggtgcatatgacttaacaaagtggcaaagcatcttacataacctgtatgatctgctggtg
aatgaaataaatctcatcagtagcagagggaagtattcttcaggctcacgtaatgttgct
gtaaaggaaaatctaattgaattaatggctgatatttgtcatcaggtttttacagaggat
accaaagtccttgaaattacccagtcatatgctgtttcacaaagaggaaccagtgaggac
acggtgccaaacaagcgcaggaggattgagcttggctggagggtcattcaagacaacgtg
caaagatcacagaaggattttgatgtcataccttggttacagattacaagtcagctagta
tccaaatatcccatgagtcttcctaacagtgagctgcctgccttactcagtgtccttcac
cagttactgcctcagcagcgccgaggagaaaggaccccatacgtgctgaagtgtctcaca
gagatagctttgtgtcaaaaccagaaaactgatttgaaaagcactcacaagctggagctc
cagagaacctgggcaaagatctggactcttactattcgcagcataagccttcagcagatt
gaagcggagagctttgggctgcttggagctatgattcaaggaaaccttgttgtaacagat
aaagagctctggaagatattttcaggacctgcatgcaaaccttcaagttctgctgtatgt
tgtttatcattagtgatgtctgcctattcagtgccggaaaatttggacataggaatggaa
cagaatagttctgaaagaaatctgggttctgtgttaagggaggcaacaatgaaatggctc
ctatccagctatttggaggaagaaatagaagaatgtgcagagttgcctcctgtgctctgc
agtgattatcctcatcttgtattacaaaaaattcttgtgagccttacaatgaagaactgc
agagcatccatgatctttttccaaaatgatgcaaaatgtgagcaacatgagcaagggaaa
gaagaaaataatttttctgatattgaagagctgtacctgcagactacatttgatgaaatg
gatattttcactagctttgcagtaaatgttgccgataaaaatgtgactggtttgagactt
gccatcaacgaaaatcttagggaaacactggagaactgccttttagcaatgtcagaaaag
cttctaagcagttatggtcctaagtctaaggttgttgctgctgaacaccttgtccgatgt
gtcaaactcttggttggtgttctgggttgctattgctacactggtatttttaaagaggag
gatgcctgtaagtcagcattgttccagaatgctaagtctctgatgcattatgccggagaa
agcatttcccagtctaaaaacaaactaaatgaagatacccagatcaacacattgaggact
ttgataatgcagtgtacaaaatgtttgtgcaattgtaccaagaacagtgctaataagatg
ctctctaatatattcctgcgtttgttaacatcaaaatttatgaatgatctgatagatatt
tgcaacaatctgatgacagttactggaaagccaagtgtactgggagaagtggatcttagg
aatgatcctgaggagagtataatggaggtagataaccgggcatctgatgatttgtttgat
aatcattcagtagctgacatcagtgatacaaatgaatctggtgacatgcaaactgtaaca
ggtgctttgagcccattagctgaagaacagttgacaaagcaggatttacttctccttgaa
attgtgaggttcttatgtatttgtgtaactacagtccgagttcagacactgagcttccga
gcctctgatattcggaggaggctgttaatgctgactgaaggcagtgtctttgacagcact
aagccactgcatctgcacatgtacttgatcctgttgaaggagctccctactgaagaacat
ctcttgcctgcagtagatgttgatatgcttcttaagcctctttccgctgtgtgttctttg
tatcgtcgagatcaagaagtttgtaaagtaattctaaatgatttgctccctatagcagta
gggttggcccagttcaatgaacatgctgaagaggcggggaatgccaaaggacagtttttg
acagttgttggagccttttggcatttatctcaaggagggaaatgcacagcatcagtaaga
gtggcccttttaaactgcatgaaagccctgcttgaggttgatccccattgcaagtgggca
atccttaatgtgaaaaatgaagatctacctgtgagtgatgctttcccacgtttccttgca
gacagtcaccatcaagttcgcattcttgctgcaaagtcaattaccagtttatttcaagat
gtgaaacagagagattcttctggaatgtcaagacctcttcccctgaagctccagcaaaag
gcttttgagaatgcatacctaagagttcaggaaggaatgagcaaactggtcaggggtgat
ggaagtcctgaagatcttttggacaagcagagtaatggaaaagcagttttgctgatgctt
ataaccatggtgctgtgctgcagcccagtctgtgaaaagcaagctctatttgctatttgc
cagtccgtgaaagagaatggattagagcctgaacttgtgaaaaaggttttgaaaaaagtg
tctgacatttttggctataaaagtatagaagacttcatgacgtcacatttagactatttg
gtgatggagtggctgaaaatgaatgacagtggatatagcctgtctgcttttccttatgtt
cttctgaactatactagcctcgaggagttctacaggtcttgttacaaagttttggttcca
cacctggtgattagaagtcagtttgaagatgtgaaatcacttgccaacaagattgacaaa
gactggagggaagttctggcagactgtttcccaaagttacttgtcaatatcctcccgtac
tttgcttatcaaagccatggaaagggtgaagtagcagaacaaagagaaatggcttctaaa
gtctacgacatgcttaaggatgagagctgcttaggaaaacagcaaatggacagtttatct
catagtaacttgccagagattgtggttgaactgttgatgaccttacatgaaccagcgggt
accacagttgaagaagggtctcacctaagtaaatatataagggaactggatcctgctcct
aatccacctcattttccatcttatgtgattaaggcaaccttggactatattagcagctgc
cataaaagcaaattaaaaagtattgtcgcagttctttctagaagtcctgattcattccag
aaaatccttctagctctatgtaagcatgcatcagacaccaaaaacatgtataagaaacac
agagttcttataatttatcatttgtttgttggtctgctacttaaagagatcaaagacagt
ttaggaggagcctgggcttttgtcctccgagatgtaatttacacccttattcaccacatc
aatagcagacccactatagtcagggacatatccatgcgcagcttttcgctctgctgtgac
cttctgcatcacgtatgccacacagctgttacgtgttgcagcgatgctctggagagccac
cttcacgttattgtaggaaccctgatacctcttgccatgggccagtctcagattcaggaa
caggtcctatgcttgttgaagtacctggtgatagataataaggataatgaaagtctgtac
caagcaatcaagtgcttagatccttttcctgaatacccagcttttcaagatttgcgagca
actcaacagaaaataaaatacagtaaaggaccatattctcttttggaggaaattaatcac
tttctctcggttggggtttgtgatacactgcccttaacacggcttgaaggactttatgat
ttacgcaaaaagttggaacaatataaagatcagatgaaggatctcctgaaaattttccag
gaaaagccagaagattctgtagtagtgaaattggtggtgagcttactgcagctgtccaag
atagcagttaaccacacaggagaaaaggcagtgctagaggctgttggaagttgcttggga
gaaataggtcccatggatttctccaccacagctcttcagcgtgctgaaaatgcactggat
tctagagcagcagaattacttgaagatagaaaacttcagtgcgtcttcataatgttagtt
caaataaacactgctttaacagataactgtattggtgttagagctgctgctgtttcctgt
ttgaaaaacatattagccaccaagtctggcaatgaattttgggaagcttataaaagtaaa
gctgatcccatgttaatctatctacagcctttcagaacatctaggaaaaagcttcttgta
gtgtctcctagtgatgcggaggctcctttagaaagattggatgacacaaacctgtggatt
cctctgggagaaagtcacgagacctggatcaagcacctaactagttcaatactagacagt
ggaggtgtgaaaaatgaagttctccagttaatgaagccactgtgtgaggtgaaaacagat
ctgtgtcaaactttgcttccatacctgattcatgatatccttcttcatgactcagatgaa
tcttggagaaatcttttgtcacttcatatccagaagttttttacagcctgttgcaaattt
gcctcatctagtagatctactccaaattctgattcatcagaacaagaaacccatagtttt
agaagtttggataaagtgtctcgacgagccatgcttgctgttgttgattacttgagaaga
caaaagagatctgtttcaggtacagtttttgatgacagcttctggctagatctgaattat
ctggaggttgctatagcagcacagtcttgtgctgctcacttcacagccttgctctatgca
gaaatctacgcagacaagataaatagggacaaggagcaagaaagatcttcctttaaagca
gctaagagattgacatttgaagagggaagtcaaagaacacctattactactttgaatgaa
aaaagtaaagaagaaactggcataagtttacaggaccatctcctggacatctacagaagc
attggagaacctgacagtctttatggctgtggtggaggaagaatgttacagccattagca
cggataagaacatacgagcatgaagcagtatgggggaaagcccttgtaacatacgacctt
gagacaagcctctctccatccactcgccaggcaggaataatagaggctttgcagaatttt
gggctttgccacactctttccatgtacttaaaagggctggaacatgaaaacactgagtgg
tgtgcagaactccaggaaatacgctaccaggcggcgtggaggaatatgcagtggagccac
atctcttctgtcaaagatgaagtaggaagtcaagggtaccatgaatcattgtatgatgct
cttcagtctttacgagataaggaattctctgctttccatgacagtcttaaagatgccaga
gtgaatgaagtaaaagagctgtgcaaggggagtcttgagtctgtttattcattatatcca
accctttgcagactacagctaattggagagctggaaaatgcaggtctgctgttctccaga
tctgttactacccaacaactgaaagatgtttatttgaaatggcagagacagtcacagctt
ctcaaagacagtgacttccatttccaggaacctgtcatggctctgcgcactgtaattttg
gaaatcttacttgaaaaggagaatgaaaataccaaaagagaatgtattaaagacctcctg
accaagcatctagtggagctctctagattggcaagaactgctaaaaacactcagcttcca
gaaagagctatgtttcaaatcaaacaacacaatccaaatggaaatggagtttctgaatgg
caacttgaggaagctcaggttttctgggctaaaaaggaagagagtcttgggctaaatata
cttaaaacgatgattaaaaaattagatgcagattggtttcaggtggagaatgatcctcac
ctgaaattgatgtatacagagtgcctgaggctctgcggaacctggttagcagaaacatgc
ttggaaaaccctacagtcatcatgcagaaatacttagaaaaggcagtggaaattgctgca
agccacagtggagacagcagtgatgagcttaagaaaggaaagatgaaggctttcctctcc
ttggctcgtttttctgataatcagtaccagcgaattgagaattacatgaaatcctccgag
tttgaaaataagcaggcattgctgaagaaggccaaggaggaggttggtctcatcagggag
cgtagagttcagctcaacagatacacagtgaaggttcagcgagaacttgagttggatgaa
ggggcaatacaggccctgaccgaggatcgtaaacgcttcttgtgtaaagcagtagagaac
tacatcagctgtttgctaagtggagaagaacatgatatgtggatattccggctgtgctcc
ctatggcttgaaaattctggagttgatagagtcaatgaaatgatgaagaaaaacgcacag
aagatcccttcatacaagttcttgcctctgatgtaccagctggctgctcggatgggaacc
aagatgatgggtggtttaggatttcacgaagttttgaataatctaatgtctcgaatttca
ctggatcatccacatcatactttgtttattatattagctttggctaatgctaacaaagat
gaactcctcacaaaaccagatgcaataagaagaaataagttaattaaaaatgcaccaaaa
gaaatctcccagcttgatgtggacagaatggaagctgctagcactataatgaatattgta
aggaaaagaagagctcctatggttagagacattgaagcactttgtgatgcttacatcaca
ttagcaaatttagattctactccatggaaatctcaaagaaaaggaataagtattccaggt
gaccagccaattattaaactgaagaacttggaggatgttcctgttcctaccatggaaatt
aaggtggatcccacaggacaatatgaaaatttggtcacaataagttctttcaggcaagaa
tttcgtttagcaggaggcatgaatctgcctaaaataattgattgtgtaggatcagatggt
aaagaaaggaggcagctggttaaggggcgtgatgacctgagacaagatgctgtcatgcaa
caagttttccagatgtgcaatacattgctccagcaaaacactgaaacacgaaagaggaaa
ttaaatatccgaagatacaaggtggttcccctctcccagagaagcggagttctggagtgg
tgctcaggaacaactcccattggagagttccttgtgaatgccgaagaaggagctcacaag
agatacaggccaaaggattactccagtaatcagtgtcataagattatgctggatgcccaa
aagaaacattctgatgagaaatacagaatcttcatggaagtctgtgagcattttcaacct
gtgttccggtatttttgcatggagaaattcctggacccagctgtgtggtttgaaaaacga
ttggcgtacactcgcagcgtggctacatcttctatagttggctacattcttggacttgga
gacagacatgttcagaatatcttgatagatgaacaaacagcagaactggtgcatatagat
ctgggggttgcttttgagcaaggcaaaatccttcccacaccagagactgttccatttagg
ttaaccagggacattgtggatggaatgggtatcaccggtgtggagggggtcttcagaaga
tgctgtgagaaaacaatggctgttatgaggaattctcaagaagccttactgactattgta
gaggtgctgctctatgatcctcttttcgactggaccatgaaccccttgaaagctttatat
ttgcagcagaggccagaggatgaggctgacatgagctctacacttggtactgatccacaa
gaacctaaaagaaaagccagcagcgatgaccagagttttaacaaggtggctgagcgtgtt
ctgatgagactgcaggagaagctgaaaggtgttgaggagggaacagtgctcagtgtggga
ggccaggtgaacctgctcatacaacaggccatggaccctaaaaatctgagccgtctcttt
cccggatggaaaccctgggtgtga

DBGET integrated database retrieval system