KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099382Help
Entry
102099382         CDS       T02921                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00350  Tyrosine metabolism
phi01100  Metabolic pathways
Module
phi_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102099382 (GSTZ1)
Enzymes [BR:phi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102099382 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 102099382
NCBI-ProteinID: XP_005520288
LinkDB All DBs
Position
Un
AA seq 217 aa AA seqDB search
MSAAAAKPILYSYFRSSCSWRVRTALALKGISYDLVPVNLIKDGGQQFSAEFKALNPMQQ
VPALKIDGIILSQSLAIINYLEETRPNPRLLPQDPKKRAQVRMIADHIVSGIQPLQNLSV
LKQIGEKKMEWAQNCITSGFQALEQILQQTAGRYCVGDEVSMADLCLVPQVANAERFKVD
MGPYPTITRINKALLELEAFKISHPSRQPDTPAELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgccgccgccaagccgatactttacagctatttccgaagttcctgttcttgg
agagtgcgaaccgcactggctctgaaaggaatttcgtatgacctggtaccagtgaacctc
attaaggatggagggcagcagttttctgctgaattcaaggcactgaatccaatgcagcaa
gtcccagccttgaaaattgatggaatcatcctttctcagtcactagctataattaattac
ctagaagagacacgtcctaaccccaggctcctgccccaagatccaaagaagagagcccaa
gtcagaatgatcgctgatcacattgtctctggcattcaaccactccagaacctgagtgtc
ctgaaacaaataggggagaaaaaaatggaatgggctcagaactgtatcacctctggcttt
caagcactggagcagattctgcagcagactgctggacgctactgtgtgggggatgaagtt
tccatggctgatctgtgtttagtgcctcaagttgccaatgctgaaagattcaaagtggac
atgggtccatatcccacaataaccagaataaataaagctctcttggagttagaggccttc
aaaataagccacccttcccggcagccagatactcctgcagagctgcgagcttga

DBGET integrated database retrieval system