KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099407
Entry
102099407         CDS       T02921                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04012  ErbB signaling pathway
phi04068  FoxO signaling pathway
phi04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102099407 (CDKN1B)
   04068 FoxO signaling pathway
    102099407 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102099407 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102099407
NCBI-ProteinID: XP_005527065
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRELKKHLQEMEEAYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCIAQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ANSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggccagacag
tcggagtacccgaagccgtctgcgtgcaggaacctcttcgggccggtgaaccatgaagag
ctcaacagggagttgaagaaacacctgcaggagatggaggaggcgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggaa
aaagggagctcgcccgacttctacttcagaccccccaggctacggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcattgcccagaggaaaagacccgcggccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccaattcagtggagcaaacacccaagaaatcaagcccaggaagacatcaaacgtaa

DBGET integrated database retrieval system