KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099451
Entry
102099451         CDS       T02921                                 

Gene name
GPR161
Definition
(RefSeq) G protein-coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102099451 (GPR161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phi04030]
    102099451 (GPR161)
G protein-coupled receptors [BR:phi04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    102099451 (GPR161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Other DBs
NCBI-GeneID: 102099451
NCBI-ProteinID: XP_005523996
LinkDB
Position
Un
AA seq 580 aa
MPQQPCRWKHFCLVLSSLVCPQAIYCPFACPSKICSFLYIPYTTAAQHVLAAPGLHTLTM
NSNSSLSNGKGLRNLTTEEDGAVRVTESIAIIVIAIFICLGNLVIVVTLYRKSYLLTLSN
KFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYMLISSASMLTLGLIAI
DRYYAVLYPMVYPMKITGNRAVVALVYVWLHSLIGCLPPLFGWSSLEFDQFKWMCVAAWH
KEAAYTAFWQIWCALLPFVVMMICYGFIFRVARIKARKIHCGTVVIVEEDSQRNGRKNSS
TSTSSSGSRRNAFQGVVYSANQCKAFITILVVIGAFVITWGPYMVVITSEALWGKNSISP
ALETLATWLSFSSAICHPLIYGLWNKTVRKELLGMCFGDRYYRKSFVQRHRTSRLFSISN
RITDLGLSPHLTALMAGGRPLGNSSSTGDTGFSCSQDSGTDTMLLEDYSSDGPHAPHCIC
PPRRRSSVTFEDEVEQIKEAAKNSVLHVKAEVHKSLDSYAASLARAIEADVKLSLFGEDA
LPGALFPLWTPAGNSGNARRGARPHASQRLKLQSIDEGNV
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgccacagcagccatgcagatggaagcatttctgcttggtgttgtcctctttggtctgc
ccacaggcaatttactgccccttcgcttgcccatctaaaatatgcagtttcctgtatatt
ccatataccacagctgctcagcatgtcttggctgccccaggtctgcacactctgaccatg
aacagcaattcctccctcagcaatgggaaaggcctgaggaacctgaccacggaggaagat
ggggcagtcagagtcaccgagtccattgctataattgtcattgccatcttcatctgtttg
ggcaacttggtgattgttgtcactctgtatcgcaagtcgtaccttctcaccttgagcaac
aagtttgtgttcagcctgaccctctccaactttctactctccgtgctggtgctgcctttt
gttgtcaccagctccatcaggcgagaatggatcttcggggttgtttggtgcaatttctcc
gccctgctctacatgctgatcagctcagccagcatgctcactctgggactcatagctata
gacaggtactatgctgtgctgtacccgatggtttatccaatgaagataacgggcaacaga
gcagtggtagctcttgtgtacgtgtggctgcattcccttattggctgcctccctcccctt
tttggctggtcctccttggagtttgaccaattcaagtggatgtgtgtggccgcctggcac
aaggaggctgcctacacggccttttggcagatctggtgcgcgctgctgccgttcgtggtc
atgatgatctgctatggattcatattccgtgtggcaaggattaaggcccgcaaaatccac
tgtgggactgttgtcattgtggaggaggactcacagaggaatgggaggaagaactccagc
acctccacgtcctcctctggcagccgaaggaacgctttccaaggggttgtttactctgcc
aaccagtgcaaagctttcataaccatcttggttgtcatcggagctttcgtcattacgtgg
ggaccttacatggtggtaataacatcagaggcactttggggtaaaaacagtatttcccct
gctttggagacattggctacatggctgtccttttccagtgccatttgccatccgctaatt
tatgggctgtggaacaagacagtgcgcaaggaactcctggggatgtgctttggggatcgg
tattaccgcaagtcctttgttcagcggcacaggacatcgaggctcttcagcatttccaac
aggatcacagatttgggactatctcctcaccttactgccctcatggcaggtgggaggcca
ctgggaaacagcagcagcacaggagacacaggtttcagctgctcacaggattcaggaaca
gatacgatgcttcttgaagattatagctcagatggccctcatgccccacactgcatctgt
ccccctcgaaggaggagttcagtgacatttgaagatgaggtggaacaaattaaagaagct
gcaaagaattctgttcttcacgtaaaagctgaagtccataaatctctggacagttatgca
gccagcctggcccgagctatagaagctgatgtgaaactcagcctgtttggggaagatgct
ttaccaggagccctgttccccttgtggactcctgcaggaaacagtgggaacgcccggcgt
ggtgccaggccccatgccagccaaagactgaagttgcagagcatcgatgaagggaacgtt
tga

DBGET integrated database retrieval system