KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099472Help
Entry
102099472         CDS       T02921                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00051  Fructose and mannose metabolism
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi00520  Amino sugar and nucleotide sugar metabolism
phi00524  Neomycin, kanamycin and gentamicin biosynthesis
phi01100  Metabolic pathways
phi01200  Carbon metabolism
phi04910  Insulin signaling pathway
Module
phi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102099472 (HK1)
   00051 Fructose and mannose metabolism
    102099472 (HK1)
   00052 Galactose metabolism
    102099472 (HK1)
   00500 Starch and sucrose metabolism
    102099472 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102099472 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102099472 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102099472 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phi04131]
    102099472 (HK1)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102099472 (HK1)
Membrane trafficking [BR:phi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102099472 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102099472
NCBI-ProteinID: XP_005530572
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQTKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSPEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMKNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTTYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgataagtacctctacgccatgcggctctctgatgaaacgctgctggatgtcatg
gctcgcttcaggagagagatgaagaatggcctctccagggattttaacccaacagctgcg
gtgaagatgcttcccacctttgtgaggtccattcctgatggttcagagaaaggagatttc
attgcgctggatctcggcggttcttacttccgaattcttcgggtaaaggtatcgcatgaa
aaaaagcagacggtgcagatggaaagtgaaatttataataccccagaagacatcatgcac
gggagtggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactgccagtcgggtttacattctccttcccctgtcgacaa
accaagctagatgagggtattctgataacctggacgaagcgcttcaaagcgagcggagta
gagggagcagatgtcgtgaggctgcttaacaaggccatcaagaaacgtggggactacgat
gcggatatcatggctgtggtcaacgacaccgtggggaccatgatgacctgtggcttcgac
gaccagcgctgcgaagtcggcttgatcattggcaccggcaccaacgcctgctacatggag
gagatgcggcacatcgacctggtggagggggacgagggcaggatgtgcatcaacactgag
tggggggcctttggagatgacggctcgctggaagacatcaggaccgagttcgatcgagag
attgaccgtggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaagggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtttgaacaaagccaaagaaatcctgacccggctgggg
gtggagccgtcccccgaggactgcatcgctgtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggtggcctccaccctgggcgccatcctcaaccagctgcgggataac
aagggcgtgggccggctccggaccaccgtgggggtggatggctccctctacaagatgcac
ccacagtacgcccggcgcttgcacaaaaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcgggaagggggcggccatggtgacggccgtggcg
taccggctgtcggagcagcaccgcctcatcgacgagaccctggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcagagatggaagcggggctgaag
aagaagactcacgagacggccaaagtgaaaatgctgcccacctttgtccgcagcacgccg
gatgggacagagaatggagactttctggcacttgaccttggaggaacaaactttagagtt
ttgctggtgaaaatccgcagcggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcccatagaggtgatgcagggaacaggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattatatggggataaaaggcgctcgtcttcctcttggcttc
accttttccttcccttgcaagcagaccagcctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtatatttacttagagaagga
attaaaagaagagaggaatttgatttggatgtggtggctgtggtgaatgatacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaattgggctcattgtgggaacg
ggcagcaatgcctgctacatggaggagatgaaaaacatagagatggtggatggtgagcaa
gggcggatgtgcgtgaacacagagtggggagcgttcggggacaacgggtgcttggacgac
atcaggacaacatatgacaaagcagtggatgacttctcactgaatgctggaaagcaaagg
tatgagaaaatgatcagtgggatgtacctgggggaaatagtccgcaatattttgatcgac
ttcaccaaacggggtttcctgttccgaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
cgaaccatcctccagcagctggggctcaacagcacctgcgacgacagtatcatcgtcaag
acggtctgcggggcagtgtcgaggcgagcagctcagctgtgtggcgctggaatggctgcc
attgtagataaaattagggagaacagagggttagagcgcctggagataacggttggtgtg
gatggcactctctacaaactccacccacacttttcaaggatcatgcaccaaacagtcaaa
gacctggcacccaactgcgacgtgaccttcctgctgtcggaggacggcagcgggaaaggg
gcagcgctcatcacagcggtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system