KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099659
Entry
102099659         CDS       T02921                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04068  FoxO signaling pathway
phi04110  Cell cycle
phi04115  p53 signaling pathway
phi04218  Cellular senescence
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
phi04371  Apelin signaling pathway
phi04510  Focal adhesion
phi04530  Tight junction
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102099659 (CCND1)
   04340 Hedgehog signaling pathway
    102099659 (CCND1)
   04371 Apelin signaling pathway
    102099659 (CCND1)
   04068 FoxO signaling pathway
    102099659 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102099659 (CCND1)
   04115 p53 signaling pathway
    102099659 (CCND1)
   04218 Cellular senescence
    102099659 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102099659 (CCND1)
   04530 Tight junction
    102099659 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102099659
NCBI-ProteinID: XP_005531841
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctatttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctcgagtccagtctacgc
caggcacagcagcacaatgtatcttcagaaacaaagactgtagaggacgaagcagacctc
tcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system