KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099948
Entry
102099948         CDS       T02921                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102099948 (CSNK1A1)
   04340 Hedgehog signaling pathway
    102099948 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102099948 (CSNK1A1)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102099948 (CSNK1A1)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102099948 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 102099948
NCBI-ProteinID: XP_005523742
LinkDB
Position
Un
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKSKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggttccaaggccgagttcattgtcggaggcaaatacaagctggtg
cggaagatcgggtcgggctccttcggggacatctatttggcgatcaacatcaccaacggg
gaggaagttgctgtgaagttggagtctcagaaggctcggcacccccagctgctctatgaa
agcaaactgtacaagatcctgcagggaggagttggcatcccacatatacggtggtatggt
caagaaaaggactacaatgttctagtcatggatcttctcgggcccagcctggaagacctc
ttcaacttctgttctcgcaggtttacgatgaaaacagtacttatgctagcagaccagatg
atcagtagaattgaatatgtgcacacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgactttggtttggccaaaaagtaccgggacaacaggacaaggcaacac
ataccatacagagaagacaaaaatctcactggcacagctcgatatgccagcatcaatgca
caccttggcattgagcagagtcgtcgggatgacatggagtctctaggctatgtattgatg
tactttaacagaaccagtctgccttggcaaggattaaaggctgcaacaaagaagcaaaag
tatgaaaagattagtgaaaagaaaatgtccactcctgttgaggttttgtgtaaggggttc
cctgcagaatttgccatgtatctgaactactgtcgtggcctgcgctttgaagaggcacca
gattacatgtatctgaggcaattattccgtattcttttcaggaccttgaaccaccagtat
gactacacattcgactggacaatgttaaagcagaaagcagcacagcaggcagcctcttcc
agtgggcaggggcagcaggcccaaacccccacaggcaagcaaactgacaaatccaagagt
aacatgaaaggtttctga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101922
Entry
102101922         CDS       T02921                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase I isoform delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
phi04540  Gap junction
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102101922 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102101922 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102101922 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102101922 (CSNK1D)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102101922 (CSNK1D)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102101922 (CSNK1D)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102101922 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 102101922
NCBI-ProteinID: XP_005530675
LinkDB
Position
Un
AA seq 409 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
AEDAERERREREERLRHTRNPAVRGLPSTASGRLRGTQDVAPPTPLTPTSHAANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQNSIPFEHHGK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggagttgagggttgggaaccggtaccggctgggccgcaagatcgggagcggctccttc
ggggatatctaccttggaactgatattgctgctggagaggaggttgcaataaagttggaa
tgtgtgaaaaccaaacatcctcagctccacatcgagagtaaaatctacaaaatgatgcag
ggtggagtgggtattcccacaattaagtggtgtggagctgaaggggactacaacgttatg
gtgatggagttgttgggaccgagtcttgaagatctcttcaatttttgttcaaggaaattt
agtctcaagacagtccttttacttgctgaccaaatgattagtcgaattgagtatattcac
tctaagaacttcatccaccgagacgtgaagccagataacttcttaatgggcctggggaag
aaaggcaatcttgtctacataatagactttggactagcaaagaagtatcgagatgctcga
actcatcaacatattccatatcgtgaaaataaaaacttaacaggaactgcccgttacgca
tctatcaacactcatctcggaattgagcaatctcgcagagatgacttggaatccttgggc
tatgtactgatgtattttaacctgggctccctcccctggcagggactgaaagcagcaaca
aagaggcagaaatacgaacgtatcagtgaaaagaaaatgtctacacccattgaggttttg
tgtaaaggatatccttctgaatttgccacgtacttgaatttctgccgttctttgcgtttt
gatgacaagccagactattcctatctaaggcaattattcagaaacctctttcatcggcaa
ggattctcctatgactatgtatttgactggaacatgttgaaatttggtgcaagcagagcg
gctgaagatgctgaacgtgaaaggcgagaacgagaggaaagattaagacatacacgaaat
ccagctgtacgtggattaccctccactgcttctggcaggctaagaggaacgcaagatgta
gctcctcctactccccttaccccaacttcacatgctgccaacacctctcctcggccagta
tccggtatggaacgagaaaggaaagtgagtatgagattacatcgtggtgccccagtcaat
atctcctcgtctgatttaacaggccgacaagatacctctcgcatgtcaacttcgcagaat
agcattcctttcgaacaccatggcaagtag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104998
Entry
102104998         CDS       T02921                                 

Gene name
CSNK1G1
Definition
(RefSeq) casein kinase 1 gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102104998 (CSNK1G1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102104998 (CSNK1G1)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102104998 (CSNK1G1)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102104998 (CSNK1G1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 102104998
NCBI-ProteinID: XP_005521394
LinkDB
Position
Un
AA seq 456 aa
MDHPNRDKDERQRTTKGMPGRSGHGSRPSSSASSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAAEGLPQVYYFGPCGKYNAMVLELL
GPSLEDLFDLCDRTFTLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEH
VIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPVEVLCENFPEEMATYLRYVRRLDFFER
PDYDYLRTIFTELFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGTSAVTRDSHIHRDRPS
QQALRNQASSDRRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDPTGA
HSNAPITAQAEVEVVEEAKCCCFFKRKRKKTAQRHK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaccatcctaatagggataaggatgaaaggcagcggacaacgaaagggatgccggga
aggagtgggcacggttctcggccgagctcatcggcgtcttccggcgttcttatggtggga
cccaacttcagagtgggcaagaagattgggtgtgggaactttggagaactcagactaggt
aaaaatctctacaccaatgaatatgtagcgatcaaactggaaccaattaaatctcgggca
ccacagcttcacttagaatacagattttataaacaacttggaagtgcggctgaagggctc
ccccaggtgtattatttcggaccttgtggaaagtacaacgccatggtgctggagctgctt
ggtccgagcttggaagatctgtttgacctctgtgataggacgttcactctgaagacggtg
ttaatgatcgccattcaactgatctctcggatggagtacgtgcattccaagaacctcatc
taccgcgatgtcaagccggagaacttcctcattggccggcagggcaataagaaggagcac
gtcattcacatcatagactttggattggccaaggagtacattgacccggaaaccaaaaaa
cacattccctacagggagcacaagagtctcactggaacagcgagatacatgtccatcaac
acacaccttggcaaagagcaaagtcgtcgagatgacttggaagcccttggccatatgttc
atgtatttcctccgaggcagcctgccctggcaaggattgaaggctgacaccttaaaagag
agatatcagaagattggggacacaaagagaaacactccggttgaagttctctgtgagaac
tttccagaggagatggccacgtacctccgctatgtccggcggttagacttctttgagaga
ccagactacgattacctacggaccatcttcacggagctgtttgaaaagaaaggctacacc
tttgactatgcctacgactgggttggcaggccaattcctactcctgtgggatctgtccat
gtagattctgggacatctgcagtgacaagagacagccacatccaccgggatcgaccatca
caacaggcccttcgcaatcaggcgtcatcggatcgccgaggagagtgggagatccagcca
agccggcagacaaatacctcgtacttgacatctcatttggctgcagatcgacatggagga
tcagtgcaggtggtgagctcaaccaacggggagctgaatgtggacgacccaacaggagca
cactccaacgcacccatcacagcgcaggcggaggtggaggtggtggaggaagctaagtgc
tgctgcttctttaagaggaaacggaagaagacggctcagcgtcacaagtga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107375
Entry
102107375         CDS       T02921                                 

Gene name
CSNK1G3
Definition
(RefSeq) casein kinase 1 gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102107375 (CSNK1G3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102107375 (CSNK1G3)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102107375 (CSNK1G3)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102107375 (CSNK1G3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 102107375
NCBI-ProteinID: XP_005528170
LinkDB
Position
Un
AA seq 456 aa
MENKKKDKDKPDERMTRPSGRSGHNPRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNDYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCGRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQN
IHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPVEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLLDRKGYMFDYEYDWIGKQLPTPVGSMHSDPAMSSNREAYQHRDRMQQS
KNQSTEHRAAWDSQQTNPHHLRVHLASDRHGGSVQVVSSTNGELNTDDPTAGRSNAPITA
PAEVEVMDETNCQKVLNMWCCCLFKRRKRKTIQRNK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaaaataaaaaaaaagacaaagacaaaccagatgaaagaatgacacggcccagtggg
agatcaggccataatccacgtggaactggttcatcaaattctggagtgttaatggttggc
cctaatttcagagttggtaaaaaaattggatgtggtaattttggagaactacgattagga
aaaaatttatacacaaatgactatgtggcaattaagctggagccaatgaagtcgagagca
ccacagctacatttggaatacagattctacaagcagctaggatctggagatggaatacct
caggtttattattttggcccatgtggcaaatataatgctatggtgctagaactacttgga
cctagtctggaagatttatttgacttgtgtggtaggacattttctcttaaaaccgttctt
atgatagccatacagttgatttctcgcatggaatatgtgcattcaaagaacttgatatac
agagatgtaaaacctgagaacttcttaataggacgacctggaaacaaaacccagcaaaat
attcacattatagactttggtttggcaaaggaatacgtagatccagaaacaaagaagcac
ataccatatcgagaacacaagagccttacaggaacagctagatacatgagtataaataca
catttaggaaaagagcaaagtagaagagatgacttggaagctttgggtcatatgtttatg
tattttctcagaggaagtcttccatggcaaggtttaaaggcagatacattaaaagaacgt
taccagaaaattggagacactaaacgagcaactcctgtagaagtattgtgtgaaaacttc
ccagaggaaatggctacttacctgcgttacgtaagaaggttagatttttttgaaaagcca
gactacgactacttgagaaagctcttcacagacttacttgatcggaaaggctatatgttt
gattatgaatatgactggattggcaaacagttgcctactccagtgggttcaatgcattca
gaccctgcaatgtcttcaaacagagaagcatatcagcacagagacagaatgcaacaatcc
aaaaatcagtcaacagaacatagggcagcttgggactcacagcaaaccaatccacatcat
ttgagggtccacctggcatctgacagacatggtggctctgtacaggtagtaagctcaaca
aatggagagctgaacacagatgacccaactgcaggtcgttcaaatgcacccatcacagct
cctgcagaagtagaagtaatggatgaaacaaactgccagaaagtgttgaacatgtggtgc
tgctgcttattcaagcggaggaaaaggaaaaccatccagcgcaacaaatga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109201
Entry
102109201         CDS       T02921                                 

Gene name
CSNK1G2
Definition
(RefSeq) casein kinase 1 gamma 2
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102109201 (CSNK1G2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102109201 (CSNK1G2)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102109201 (CSNK1G2)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102109201 (CSNK1G2)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 102109201
NCBI-ProteinID: XP_005531392
LinkDB
Position
Un
AA seq 415 aa
MDFDKRGGKGELEEGKRMSKTGGGRSGHGGRGAGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNAEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPVEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFERNGYVFDYEYDWAGKPLPTPIGTMHSEVQVQPPNRDKAQPHTK
HQVMSSTNGELNTDDPTAGHSNAPITAPTEVEVTDDTKCCCFFKRRKRKTTKRRK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgataagagaggagggaaaggggagctggaggaaggtaaaaggatgtccaag
acaggtggaggaaggagtggtcatggaggccggggtgctggaaccaactcgggagtctta
atggtgggtcccaacttccgtgtcggcaagaagattggatgcggcaatttcggggagctc
cgtctagggaagaatctctacacaaatgaatacgtagctatcaaattggaacccataaaa
tctcgggccccccagctgcacctggagtatcggttctacaaacagctcggcaatgcagaa
ggaattcctcaggtttattactttggcccctgtgggaagtacaacgccatggtgttggag
ctgctcggacccagcctggaagatctctttgatctgtgtgatcggaccttcacgctcaag
actgtcctgatgattgcgatccagctgatcacacggatggagtacgtccacaccaaaagc
ctgatctacagagatgtcaagccagagaacttcctggtggggcggccgggcagcaagcgg
cagcacaccatccacatcattgattttggcctggccaaagagtatattgatcccgagacc
aaaaaacacatcccctaccgagagcacaagagcctgacagggacagcgcgctacatgagc
atcaacacccacctggggaaagaacaaagccgcagggatgacctggaagcattagggcac
atgtttatgtacttcctccgtgggagccttccttggcaaggcctcaaggccgacacacta
aaggagaggtaccagaagattggtgacaccaaaagagccaccccagtggaggtgctctgt
gagaacttcccagaggagatggccacgtacctgcgctacgtgcggcggctggatttcttc
gagaagcccgactacgactacctgaggaagctcttcacagacttgtttgagaggaacggt
tacgtgttcgactacgaatatgactgggcagggaaacctctgcccacccccattggcacg
atgcacagcgaggtgcaggtgcagcccccgaacagagacaaagcacagccacacaccaaa
caccaggtgatgagctccaccaacggagagctgaacacagatgacccgacggcaggacat
tcaaacgcccccatcacagcccccaccgaggtggaggtgacagacgatacaaagtgctgc
tgtttcttcaagagaaggaagaggaaaaccaccaagcgtcgcaagtga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112017
Entry
102112017         CDS       T02921                                 

Gene name
CSNK1E
Definition
(RefSeq) casein kinase I isoform epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04068  FoxO signaling pathway
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102112017 (CSNK1E)
   04340 Hedgehog signaling pathway
    102112017 (CSNK1E)
   04068 FoxO signaling pathway
    102112017 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102112017 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102112017 (CSNK1E)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102112017 (CSNK1E)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102112017 (CSNK1E)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102112017 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 102112017
NCBI-ProteinID: XP_005527669
LinkDB
Position
Un
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDMDRERREHEREERMGQLRGSATRALPPGPPAGATANRLRNVTEPMASTPTSRIQQSG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRISASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagcttcgagtgggaaacaaataccggctgggcagaaagattggtagtggttcgttt
ggagacatttacctaggagccaatattgcgactggtgaagaggtggccatcaaactggaa
tgtgtcaaaaccaagcatcctcagctccacattgaaagcaagttctacaagatgatgcag
ggaggagtgggtatcccctccattaagtggtgtggagcagagggagactacaatgtgatg
gtgatggaactcttggggcccagcctggaagatctcttcaacttctgttcccgcaaattt
agtctcaagacagttctgctgctggcagaccagatgattagccgtattgagtatattcat
tccaagaacttcatccatcgggatgtcaagccagacaacttccttatgggccttggcaaa
aagggcaacctagtatatatcattgattttggtttggccaagaagtaccgagatgcccgg
acccaccagcacatcccttatcgggaaaacaagaatctgactggcacagcccgttatgcc
tctatcaacacccacctgggaattgaacaaagtcgccgtgatgacctggagagcctgggt
tatgtgctcatgtatttcaacctgggctcgctgccctggcagggcctcaaggctgccacc
aagcgccaaaagtatgagaggatcagcgagaaaaagatgtcaacgcccatcgaggtgctg
tgcaaagggtacccttctgagttctcaacatacctcaacttctgccgttcactgaggttt
gatgataaacctgactactcgtacctgcggcaactcttccgcaacctcttccaccgccaa
ggcttctcctacgactacgtctttgactggaacatgcttaaatttggagcagcccggaac
cctgaggatatggatcgggagcggcgagagcacgagcgagaggagaggatggggcaactc
cgagggtcagccacgcgagcgctgccccctggcccacctgctggagccactgccaaccgt
cttcgcaatgtcaccgagcccatggcctccacccccacctcccgaatccagcagtccggc
aacacgtcccccagagcaatctcaagagtggacagggagcggaaggtcagcatgaggtta
caccgaggagctcctgccaacgtctcctcatctgacctcacagggcggcaagaagtgtca
cggatttcagcatcacagacaagtgtgccatttgatcaccttgggaagtga

DBGET integrated database retrieval system