KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100017Help
Entry
102100017         CDS       T02921                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00030  Pentose phosphate pathway
phi00051  Fructose and mannose metabolism
phi00052  Galactose metabolism
phi01100  Metabolic pathways
phi01200  Carbon metabolism
phi01230  Biosynthesis of amino acids
phi03018  RNA degradation
Module
phi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102100017 (PFKP)
   00030 Pentose phosphate pathway
    102100017 (PFKP)
   00051 Fructose and mannose metabolism
    102100017 (PFKP)
   00052 Galactose metabolism
    102100017 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102100017 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:phi01009]
    102100017 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:phi03019]
    102100017 (PFKP)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102100017 (PFKP)
Protein phosphatases and associated proteins [BR:phi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102100017 (PFKP)
Messenger RNA biogenesis [BR:phi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102100017 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102100017
NCBI-ProteinID: XP_005528567
LinkDB All DBs
Position
Un
AA seq 785 aa AA seqDB search
MDHQPKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAFNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGMTEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEGGKVFANTDDSVCLLGMRRRN
LVFQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEA
ETGAI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcgccgggaaggccatcgcggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgacaatattgtagaggtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggcacggtgatcggcagcgcgcgctgcaaatccttccgcacgcgcgagggccggctgcag
gccgccttcaacctggtgcagagagggatcaccaacctctgcgtgatcggcggtgatggc
agcctgaccggcgccaacctcttcagggaggagtggagcgggctgctggaagagctggca
cagaaaggaaagattgatgcagaagctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctctgcacaggataattgaagttgtggatgccatcatgaccactgctcagagccatcag
aggacatttgttctggaggttatggggcgacactgtgggtatctagctctggttagtgcc
ttagcctgtggtgcagactgggtgtttattcctgaatacccaccagaggaaggctgggaa
gattcaatgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaagcctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtaaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgacagaattcttgcgagtcgtatgggtgtggaagcc
gtgcttgcccttttagaagctactccagatacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagttcagaaa
gccatggatgagggaagattccttgaggctgtgaggcttcgtggaaggagctttgaaaac
aatcttaacacgtacaaattactgtcgcacaaaaagccagatgccgagctcccaaagact
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgccgcagtg
agggctgcagtgagagttggaatgactgaaggtcacaaaatatttgctgtcattgatggt
tttgaagggttcgctagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatacttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaataatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaaacgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatcttcgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctaagaaatgagaactgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtttttgactgtcgaaaaaatgtattg
ggccatatgcagcagggtggagcaccttcaccatttgatagaaatttcgggacaaaaatt
tcagcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaagaagga
ggaaaagtatttgccaataccgatgactcagtttgtttgctgggaatgcggagacgcaac
cttgttttccaacctgtggctgagctcaagagtgaaacagactttgtacacaggattccc
aaggagcagtggtggctgaagctgcgacccctgatgaagatcctggccaagtacaagacc
agctacgatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagct
gagaccggagccatctaa

DBGET integrated database retrieval system