KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100057Help
Entry
102100057         CDS       T02921                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00052  Galactose metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102100057 (LCT)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102100057 (LCT)
    3.2.1.108  lactase
     102100057 (LCT)
Chaperones and folding catalysts [BR:phi03110]
 Intramolecular chaperones
  Others
   102100057 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102100057
NCBI-ProteinID: XP_014104721
LinkDB All DBs
Position
Un
AA seq 1931 aa AA seqDB search
MDLIYCKTVIFFLLVSLSLGIDGEFAQNFLNFSTIAGPLPHELAERLGLQDQVLPEDQQG
PAVAETQGYPCQPDLMASELPRYFSQLREREVTHYKLLLPWARVLPEGNAMRADGAQVWC
YRQLLGALAAANLRAVLVLHHGRVPGAVAAQASGKRARAFSELFVEYAEFSFHTFGDLVD
VWLSFSDLPEVLQSLPYSEPQERVQAVAAAHEGFYTALREKISPAGGKLSIALEMDHVLD
SASSELLSVSLQDSVDFVSLNLQYHCGNERDFYKKLSKFQSVWKDKDILFFSLKVLDCAS
MEEHPFRPVAAVATAINKEEAHLIGCDVNEFLDYISDVSSETNTLQENPDAVLAPQSSYQ
RVCEMFAEQSESERDSFLQDVFPRGFLWGISTGAFNIEGAWAEDGKGESIWDQFGHGAHV
HVNQTADVACDSYYKTSYDIYLLRGLHPQLYKFSVSWSRIFPAGTNKTINSKGVDYYNRL
IDRLLDSNIEPMVTLFHWDLPQALQALGGWQNESIIDVFVSYADFCFSKFGDRVKLWVTF
HEPWVISYAGYGTGEHPPGITDPGAASYKVAHTILKAHAKVWHLYNDKYRSQQLGKVGLV
LNSDWAEPKTPTSSEDVRASERYLQFMLGWFAHPVFVNGDYPDILKAQIQEVNQQCSTTV
AQLPVFTEEEKSLIKGTADFFGLSHYTSRLVSAGTNGMCTPSYESIGNFSLHVDPSWPQA
ASSWIHVVPWGLRRLLKFVSQEYTGSKIPIYIAGNGVPTEDAGDLINDTLRVDYFRQYIN
EALKAVKLDAVDVRSYIARSLLDGFEGPVGYSLKFGLHHVNFEDSNRPRTPKASAYFYSG
VIEKNGFPSQTMGRSSAPVVFDQPVPSKLPNLPASEVPSKATKVVWQKFSSQTAFERDMY
FYGTFPEDFMWGVSSSAYQIEGGWDADGKGPSIWDNFTHVPGNVNNNDNGDIACDSYHRV
EEDIYMLRALGVKNYRFSLSWPRIFPTGRNNSVNSHGVEYYNRLIDGLIANNITPIITLY
HWDLPQALQDIGGWECNELIDLFDSFADFCFQTFGDRVKFWITINEPNIIAWLGYGTGLF
PPNVKDPGTAPYRVAHILLKAHARVYHTYDDKYRASQGGVIALCPYITWAEPKTPSDPRD
IEAADRYLQFLVGWFTHPIFKNGDYPEVMKWKVGNRSEIQNLPSSRLPVLTAEEREYIRG
TADVFCFNTYSSKIVSHSTTRLKPFSYEYDQEVSLTVDSSWPSSALTDHRPVAWGLRRLL
NWIKEEYGNPPIYIIENGVGTKAKSDVDDNARIFYHKTYIDEALKAYKVDGVNLKGYNAW
SLMDNFEWVDGYEPRFGLHQIDFDNPNRPRTPKRSAMYYAEIIRNNGIPLPKEDEFLYGE
FPENFFWSVATAAYQIEGGWRADGKGLSIWDKYAHTPLRIGKDATGDVACDSYHRIEEDV
EMLKSLKVSHYRFSISWSRVLPDGTTRYINEKGLNYYERLIDALLAANIVPQVTLYHWDL
PQALQDLGGWENDAIVQRFKEYAEVLFQRLGDKVKFWITLNEPYNTAYLGYGVGTAAPGV
SVRPGRAPYVVGHNLIKAHAEAWHLYNETYRAKQGGLISIAINSDWAEPRNPHSQADIEA
ATRLMQFFLGWFAHPIFKNGDYNEVMKRRIRERSLAQGLSKSRLPEFTESEKQRIKGTYD
YFGLNHYTTVLTYNLNYPKGVMSYDSDRGVATVTDRSWPSSGSLWLKVTPFGFRKILRWI
KEEYNNPPIYVTENGVSERGAFQFNDTWRMHYFRTYINEALKAIVLDGVDLRGYTAWTLM
DNLEWAAGYEEKFGLYHVNFSDPALPRHPKASAKYYSQIINCNGFPDPATGPHPCLEQEP
EVTPTDPTPGTADIVRFLGLDLISQDAEIALYVLFALSAVGALSLALFAYKYRKLSKRSH
KQSHMELSSKM
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atggacctgatttattgtaagacagtcatcttctttctgttggtttctctcagccttggg
atagatggggagtttgctcagaattttttgaatttttccaccattgctgggcctctaccc
catgagctggcagagaggttgggcctgcaggaccaggtcctgcccgaggaccagcagggc
cctgctgtggctgaaacacagggttacccgtgccagccagatctcatggcttccgagctg
ccccggtacttctcccagctgcgcgagcgcgaggtgacgcactacaaactcctcctgccg
tgggcacgcgttcttcccgaggggaacgccatgagggcggacggagcccaggtgtggtgc
taccggcagctgctgggggctctggctgctgcaaacctcagagcagtgctggttctacac
cacggccgcgtccccggcgcggtggctgcgcaggccagcgggaagagagccagggctttt
tccgagctttttgtggagtacgcagagttcagcttccacacctttggggacctggtggat
gtgtggctgtccttcagtgacctgccagaggtccttcaaagcctgccctacagtgagccc
caggaacgagtccaggctgtggctgctgctcatgaaggattttacaccgcactccgtgag
aaaatctcaccagcaggtggaaaactgtccattgctttggaaatggatcatgtcttggac
agtgcttcatcagaattgctttcagtttctcttcaggattcagtagactttgtgtctctt
aaccttcagtaccattgtggaaatgaaagagatttctacaagaaattgagtaaattccag
agtgtctggaaggacaaagacatcttgttttttagtctaaaggtccttgactgtgcttcc
atggaagagcatcctttcagaccagtagctgccgttgccacagctattaataaagaagaa
gcacatctgattgggtgtgatgttaacgagttcttggactacatatctgatgtttcaagt
gaaacaaatactctacaggaaaacccagatgctgttcttgcccctcagtcctcctatcaa
agagtctgtgaaatgtttgctgaacagtctgaatcggagagggattctttcctgcaagat
gttttcccacgtgggttcctctggggcatatccacaggtgcctttaacatcgaaggagct
tgggcagaggatgggaaaggagagagcatctgggaccagtttgggcatggggcccatgtc
cacgtgaaccaaacagcagacgtggcatgtgacagctactataaaaccagctatgacatt
tacctgcttaggggtcttcacccccagctgtataaattttctgtatcctggtctagaatt
ttccctgctggcaccaacaagaccatcaattccaagggagttgattattacaaccgctta
attgaccgcttgttagactctaatattgagcccatggtgactctgttccactgggacctg
ccccaagctctgcaggctcttggtggctggcagaatgaaagtatcatagatgtttttgtg
agctatgcagacttctgcttttccaagtttggggatcgagtcaagctctgggttacgttc
catgagccctgggttatcagctatgctggctacggcaccggagagcatcctccaggaatc
actgacccaggagcagcgtcttacaaggttgctcacacaattctcaaggctcatgccaag
gtctggcacctgtataatgacaaataccgttctcagcaactgggaaaggtggggctggtg
ctgaactcggactgggctgaacccaagactccaaccagctccgaggatgtgagggcatct
gagaggtacctccagttcatgctcggctggtttgctcaccctgtatttgttaatggtgat
tacccagatatcctaaaggctcagatccaggaagtgaaccagcagtgctccacgacagtt
gcacagctgcctgtgtttacagaggaggagaaatccttgataaaagggactgcagatttc
tttggcctttcccattacacttcccgcctggtcagtgccggcactaacgggatgtgcaca
ccaagctacgagagcattgggaatttctccttgcatgtagatccttcctggccacaggct
gcctcttcttggatccatgtggtcccttggggattaagaaggctactgaagtttgtatcc
caggaatacacagggtcaaagatcccaatatacatagcagggaatggtgtgccgacagaa
gatgctggggatcttatcaatgacactctgcgagtggattatttccgccagtacattaat
gaggccctgaaagcggtgaaactggatgccgttgatgtccggtcctacattgctcgatcc
ctgcttgatggctttgaaggcccagtgggatacagcctaaaatttgggctgcatcatgtc
aactttgaagacagcaacagaccaaggactcccaaggcatctgcttacttctattctggt
gtcattgaaaaaaatggttttccatctcaaactatgggcagatcttctgcaccagtggtg
tttgaccaacctgtgccatcaaagctgccaaatttaccagcatcagaagttccctccaag
gcaacaaaggttgtctggcagaagttttcatcccagactgcctttgaaagagacatgtat
ttttatgggacattcccagaggattttatgtggggtgtgtcttcctctgcctaccagata
gagggaggttgggatgctgatggcaaaggacccagcatatgggataacttcacccatgtc
ccagggaatgtaaacaataatgataatggagatatagcttgtgatagctaccacagggtg
gaggaagatatttacatgctgagagccttaggggtaaagaactatcggttttcactgtcc
tggcctcgaattttccccactggaaggaacaactcagtcaacagccatggagtcgaatac
tacaaccgtctcattgatggactgatagcaaacaacatcactccaattatcactctctac
cactgggacctaccacaagctctccaggacatcggtggctgggagtgcaacgagctgatt
gacctgtttgacagctttgcagacttctgtttccagacctttggggacagggtgaagttc
tggattacaatcaatgaacccaacatcattgcctggctgggctatggcaccgggttgttc
ccacccaatgtcaaggaccctggcactgctccctacagggttgcccacatcttactgaaa
gctcatgccagggtctaccacacctacgatgacaaatacagagcgagtcagggaggggtc
attgccctgtgcccctacattacctgggctgagccaaagacaccaagtgaccccagagac
attgaagctgctgacaggtacctgcagtttttggtgggttggttcacacacccgattttc
aaaaacggggactaccccgaggtcatgaagtggaaagttgggaacaggagtgagatccag
aacctgccgtcatcgcgcctgccggttctcacagcggaggagcgcgaatacatccggggc
acagcagatgtcttctgcttcaacacatactcctccaaaattgtaagccattcaacaaca
cgtctgaagcccttctcttatgagtatgaccaggaagtttcattaacagttgacagctcc
tggccttcctcagctctcactgaccatcggcctgtggcctggggtctgaggaggctactg
aactggatcaaagaggaatatggaaaccccccaatatacatcattgagaatggcgtgggg
acaaaggccaaatcggatgttgatgacaatgccaggatattttaccacaaaacatacatt
gatgaagctttgaaagcttacaaggtagatggtgttaatctgaaaggatacaatgcttgg
tctctgatggataactttgaatgggtggatggttatgagccaagatttggattgcaccag
attgattttgacaaccccaacaggccgagaacgccaaagcgctctgctatgtactatgca
gaaatcatccgcaataatggcatcccactgcccaaggaagatgaatttttatatggagag
tttccagagaacttcttttggagtgtagcaacagcagcttaccagattgagggaggatgg
agagcagatgggaaaggacttagcatttgggacaaatatgcccacactcccttgagaatt
ggcaaggatgcgactggagatgtagcttgtgacagctaccacaggattgaggaggatgtg
gaaatgctgaaaagcctcaaggtgtctcactatcgcttttcaatctcctggtcccgagtt
ctcccagatgggaccaccaggtacatcaatgaaaagggactcaactactatgaaaggctg
attgatgcccttctggcagccaacattgttcctcaggtaactctctatcactgggacctc
ccacaggcactgcaggaccttggtgggtgggagaatgatgctatagttcagagatttaag
gaatatgctgaggtccttttccagaggctgggggataaagtaaaattttggataaccctc
aatgaaccctacaatactgcctatcttggctatggcgttggcacagctgcaccaggtgtc
tcagttcggccgggacgtgctccctacgtggtgggacacaacctgatcaaggcacatgcg
gaggcctggcacctttacaacgagacctaccgggccaagcagggagggctcatctccatc
gccatcaactctgactgggcagaaccacgcaacccacacagccaggcagatattgaagct
gccacacgactcatgcagttttttctaggttggtttgctcaccccattttcaaaaatggt
gattataatgaagtgatgaaaagaaggattcgggaacgaagtctggctcagggcctgagc
aaatcccgacttccagaatttactgaaagtgaaaaacaaagaattaaaggcacatatgac
tattttggtctaaatcattataccacagttttaacatacaacctaaactatcctaagggt
gttatgtcatatgactctgataggggcgtagccacagtgaccgaccgcagctggccgagc
tctggttccctctggctgaaggtgacaccctttggattcaggaagatcctcaggtggata
aaggaagagtacaacaaccctcccatttatgtgactgaaaatggggtctcagagagggga
gcctttcaattcaatgacacttggagaatgcattactttcgaacctacattaatgaggca
ctcaaagccattgtactcgacggtgtcgacttacggggctacactgcgtggacactgatg
gacaacctcgagtgggcagcaggttatgaggagaagtttggcctctaccatgtgaatttc
tcagaccctgccttgccacggcaccccaaggcctcagccaagtattactcacagatcata
aactgcaatggctttccagacccagcaacaggcccacatccctgtctggaacaggagcca
gaagtgacaccaacagaccccactccaggaacagctgacatcgtgcgctttttgggattg
gatttgatatcccaagatgcagaaatagcactctatgtgctttttgctctttctgcagtt
ggagcactgagcttggctctttttgcatacaaatacagaaaattgtccaaaagatcccat
aaacaatcacacatggaacttagtagtaaaatgtaa

DBGET integrated database retrieval system