KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100094
Entry
102100094         CDS       T02921                                 

Gene name
DHH
Definition
(RefSeq) desert hedgehog
  KO
K11990  desert hedgehog
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102100094 (DHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phi01002]
    102100094 (DHH)
Peptidases and inhibitors [BR:phi01002]
 Cysteine peptidases
  Family C46: hedgehog family
   102100094 (DHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 102100094
NCBI-ProteinID: XP_005532098
LinkDB
Position
Un
AA seq 413 aa
MPRWRPLALVLLGLAACLLAAPVLGCGPGRGPVGRRRLGRRQLSPLLYKQFVPNVPEQTL
GASGKAEGKVLRGSERFRDLVPNYNPDIIFKDEENTGADRLMTERCKERVNSLAIAVMNM
WPGVKLRVTEGWDEDGHHLPDSLHYEGRALDITTSDRDRHKYGMLARLAVEAGFDWVYYE
SKAHIHVSVKADNSLAVRTGGCFPGHATVMLESGERRGLAELRQGDWVLGAEPGGRLVPT
EVLLFLDRDLRQRASFVAIETASPAHRLLLTPSHLVFAARGAANGSAAFLPIFARRVRPG
DAVLAHGAGGQGLRPTRVLRVSREDGVGVFAPLTSHGTLLVNGVLASCYAVLESHRWAHR
AFAPLRLFHGLLSLLPAHPEVGNGTVPEVGMHWYSRLLYRLAGGVLGQETLQV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgccccggtggaggccgcttgctctcgtcctgctcgggctcgccgcctgcctgctggcc
gcgccggtgctgggctgcggcccgggtcggggtccggtgggtcggcggcggctggggcgg
cggcagctttcgcctctgctctacaagcagttcgtgcccaacgtgcccgagcagacgctg
ggggcgagcgggaaggcggagggcaaagtgctgcggggctcggagcgcttcagggacctg
gtgcccaactacaaccccgacatcatcttcaaggacgaggagaacacgggggcggaccgg
ctcatgaccgagcgctgcaaggagcgtgtgaactcgctggccatcgcggtgatgaacatg
tggccgggggtgaagctgcgggtgacagagggctgggatgaggatgggcatcacctcccc
gactctctgcactacgagggccgggcgctggatatcaccacgtccgaccgcgaccgccac
aagtacggcatgctggcacgcctggccgtggaggccggcttcgactgggtctactatgag
tccaaggcacacatccatgtctctgtcaaagcagataactcactggccgtccgcaccggt
ggttgctttcccggccacgccaccgtgatgctggagagcggcgagcgccggggcctggct
gagctgcgccagggtgactgggtgctgggcgccgagccaggcgggcgcctggtgcccacc
gaggtgctgctcttcctcgaccgggacctgcgccaacgcgcctccttcgtggccatcgag
acggccagcccagcgcaccggctgctcctcaccccgtcccatctggtattcgcggcccgc
ggggcggccaacggctccgccgccttcctgcccatcttcgctcgccgcgtgcgcccgggt
gacgccgtgctggcccacggggctggcgggcaggggctgcgccccacgagggtgctgagg
gtctctcgggaggacggcgtgggggtctttgcccctctcacctcccacggcaccttgctg
gtcaatggggtgctggcatcctgctatgccgtcctggagagccaccgctgggcccaccgg
gcttttgcccccctccgcctgttccacgggctcctctcgctgctgccggcccaccccgag
gtgggcaatgggacggtgccggaggtgggcatgcactggtactcccgcctgctctaccgc
ctggctgggggtgtgctgggccaggagaccctgcaggtgtag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102115
Entry
102102115         CDS       T02921                                 

Gene name
IHH
Definition
(RefSeq) indian hedgehog
  KO
K11989  indian hedgehog
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102102115 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phi01002]
    102102115 (IHH)
Peptidases and inhibitors [BR:phi01002]
 Cysteine peptidases
  Family C46: hedgehog family
   102102115 (IHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 102102115
NCBI-ProteinID: XP_005519766
LinkDB
Position
Un
AA seq 408 aa
MKPARLLLLLSGCALLLAPAVRGCGPGRVVGSRRRPPRKLIPLAYKQFSPNVPEKTLGAS
GRYEGKIARNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWVYYESKA
HIHCSVKSEHSAAAKTGGCFPGRALATLEDGAQTPLWALRPGQRVLAMDGAGRPTYSDFL
AFLDKEPRALTTFHVIETQEPRRRLVLTPTHLLFVAENASAPTAHFRPIFASLVLPGHFV
LVVAGGGSLQPAEVVRVRHRRDVGAYAPLTRHGTLVVDGVVASCFALVKEQQLAQLAFWP
LRLYHSLLGWPEVQGDGVHWYSGLLYRLGRLLLPPDSFHPLGISQAES
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagccggcgcggctgctgctgctgctgagcgggtgcgcgctgctgctggcgccggcc
gtgcgcggctgcgggccgggcagggtggtgggcagccgccgccgcccgccccgcaagctc
atcccgctcgcctacaagcagttcagccccaacgtccccgagaagacgctgggggctagc
ggccgctacgaaggcaagatcgcgcgtaactcggagcgcttcaaggagctgacgcccaac
tacaaccccgacatcatcttcaaggacgaggagaacactggcgccgaccggctcatgacc
cagcgctgcaaggaccgcttgaactccctggccatctctgtcatgaatcagtggccaggg
gtgaagctgagagtgacggagggctgggatgaggatgggcaccactcggaagagtcgcta
cattatgagggccgagctgtggacatcacaacctcggacagggaccgcaacaagtatggc
atgctggctcgcctggccgtggaggctggcttcgactgggtctactatgagtccaaggca
cacatccactgctctgtcaagtcagagcactcagccgctgcgaagacagggggctgcttt
cctgggcgggcactggcaacgctggaggacggtgcccagacgccactgtgggcactgcgc
ccaggccagcgagtgctggcaatggacggggcaggcaggcccacctacagtgacttcttg
gctttcctggacaaggagccccgtgccctcaccaccttccacgtcatcgagacacaggag
ccacgccggcgcctggtcctgacgcccacccacctgctctttgtggcagagaacgcttcg
gcgcccaccgcccacttccgtcccatctttgccagcctcgtgctcccgggacattttgtg
ctggtggtggctgggggaggcagcttgcagcctgctgaagtggtgcgggtgcggcaccgc
agggatgtgggagcctatgccccgctgacacgccatgggacactggtggtggatggcgtg
gtggcctcatgctttgctctggtgaaggagcaacagctggcacagctggccttctggcca
ctccggctctaccacagcctgctggggtggccagaggtgcagggggatggcgtgcactgg
tactcagggttgctctaccgcctgggcaggctgctcctgccccctgacagcttccaccca
ctggggatatcccaggcagagagctga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103261
Entry
102103261         CDS       T02921                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102103261 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phi01002]
    102103261 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:phi00536]
    102103261 (SHH)
Peptidases and inhibitors [BR:phi01002]
 Cysteine peptidases
  Family C46: hedgehog family
   102103261 (SHH)
Glycosaminoglycan binding proteins [BR:phi00536]
 Heparan sulfate / Heparin
  Morphogens
   102103261 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 102103261
NCBI-ProteinID: XP_005528587
LinkDB
Position
Un
AA seq 421 aa
MDEMLLLTRILLVGFICALLVSSGLTCGPGRGIGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEKGGTKLVKDLRPGDRVLVADTEGRLLYSD
FLTFLDREDGSHKIFYVIETRQPRARLLLTAAHLLFVAPQQNQSEGGAAGSRALFASRVR
PGQRVFVLGEGGRQLLPAAVHRVSLREEASGAYAPLTAQGTILIDRVLASCYAVIEEHSW
AHWAFAPFRLLQGLLAALCPLPMGDPTAPGIHWYSRLLYRIGSWVLDSDSLHPLGMMVSS
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgctgttgacaagaattctcttggtgggcttcatctgcgctctttta
gtctcctctgggctgacttgtggaccaggcaggggcattggaaaaaggagacaccccaaa
aagctgacccctttagcctataagcagtttattcccaatgtggcagagaagaccctaggg
gccagtggaagatatgaagggaagatcacaagaaactccgagagatttaaagaactaacc
ccaaattacaaccctgacattatttttaaggatgaagagaacacgggagctgacagactg
atgactcagcgctgcaaggacaagctgaacgctctggcgatctcggtgatgaaccagtgg
cccggggtaaagctgcgggtaaccgagggctgggacgaggacggccaccactccgaggag
tccctgcactacgagggccgcgccgtggacatcaccacctcggaccgggaccgcagcaag
tacggcatgctggcccgcctggccgtcgaggctggcttcgactgggtctactacgaatcc
aaggcgcacatccactgctccgtcaaagcagaaaactcggtggcggccaaatccgggggt
tgcttccctggctcggccacggtgcacctggagaaaggcgggacgaagctggtgaaggac
ctgaggcctggagacagggtgttggtggcggacacggaaggccgtctgctctacagcgac
ttcctcaccttcctcgaccgcgaggacggctctcacaagatcttctacgtcattgagact
cggcagccccgggcccggctgctgctcacggccgcccacctcctgttcgtggccccccag
cagaaccagtccgaggggggggccgccggcagccgggcgctgttcgccagccgcgtgcgg
ccgggccagcgggtcttcgtgctgggcgagggcgggcggcagctgctgccggcggccgtg
caccgcgtgtcgctgagggaggaggcgtcgggggcctacgcccctctcacggcccagggc
accatcctcatcgaccgcgtgctggcctcgtgctacgccgtcatcgaggagcacagctgg
gcgcactgggccttcgctcccttccgcctgctccagggcctgctggccgccctctgccct
ctcccgatgggagaccccacggcccccggcatccactggtactctcggctcctctaccgc
atcggcagctgggtgctggatagtgactctctgcacccgctgggcatgatggtgtcatcc
agctga

DBGET integrated database retrieval system