KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100196
Entry
102100196         CDS       T02921                                 

Gene name
SCUBE2
Definition
(RefSeq) signal peptide, CUB domain and EGF like domain containing 2
  KO
K24706  signal peptide, CUB and EGF-like domain-containing protein 2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102100196 (SCUBE2)
SSDB
Motif
Pfam: FXa_inhibition cEGF EGF_CA Ephrin_rec_like EGF_3 CUB EGF hEGF
Other DBs
NCBI-GeneID: 102100196
NCBI-ProteinID: XP_014113284
LinkDB
Position
Un
AA seq 955 aa
APGGPAALSLPGECLQARSLPGDCPRSLPDVDECALGLDDCHPDAICQNTPKLYKCMCKV
GYTGEGRKCEDIDECDNDFNGGCVHECFNIPGNYRCTCYDGFMLAHDGHNCLDTDECTFN
NGGCQHVCVNTVGSYECRCREGFFLSDNQHTCIHRSEEGMSCMNKDHGCAHICRETPKGG
VACECRPGFELSKNQRSCILTCNHGNGGCQHSCDDADNGPVCGCHPKYIMHVDGKTCLER
EEAAVEVSEGNTTAAADVDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQ
FDGKTCKDIDECQANNGGCDHFCKNTVGSFDCSCRKGFKLLTDEKSCQDIDECSFERACD
HTCINHPGTFECTCNKGYALYGFTHCGDINECSINNGGCQQLCVNTPGDYECLCHSNYKL
HWNKKDCVETKDPLSDNVSPKVLLHCIKSGGSDRCFLSCSPDVQVFSGTQDAYTLTCGRS
SQLKKKQQNANASSWLDAPAIKISITFKLNEGKCSLKKTEMFQEGLEQMIPERQNSVMES
FHYVNLTCSSGKKVHGALSRLTATREIFITADFELETSRKEVTDTCDVRCARKKTEKRFR
KTIRTLRKTVSRDQFRIRVSGTDHEVARKALKPPEPQQSCGVGQQQPGNRCDQCSPGEYS
PDGFKPCLPCPLGTYQPEAGRVSCFPCGGGLTTRHSGASLFQDCETKVQCSPGHFYNTTT
HRCIRCATGTYQPEFGQNYCISCPGNTTTDFDGSTNITQCKNRQCGGELGDYTGYIESPN
YPGDYPANTECTWNINPPPKRRILIVVPEIFLPIEDECGDYLVMRKSSSSNSVTTYETCQ
TYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRLYASENH
QEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
NT seq 2868 nt   +upstreamnt  +downstreamnt
gcgccgggcggccccgccgcgctgtccctgcccggtgagtgcctccaggcccggtccctg
cccggggactgcccccgctccctgcccgatgtggacgagtgtgccctggggctggacgac
tgccacccagatgctatttgtcaaaacaccccgaagctgtacaagtgcatgtgcaaagtg
ggttacaccggtgaagggaggaaatgtgaagacattgatgaatgtgacaacgacttcaat
gggggctgtgtccacgagtgtttcaacattccaggaaattaccgctgcacttgctacgat
ggctttatgctggctcacgatggccacaactgcctggacacggacgagtgcacgttcaac
aacggtggctgccagcacgtttgtgtcaacaccgtggggagctacgagtgccgctgcagg
gaagggttcttcctcagcgacaaccagcacacctgcatccaccgctccgaagaaggcatg
agctgcatgaacaaagatcatggctgtgcccacatctgcagagaaacacccaaaggagga
gttgcctgtgaatgccgaccaggatttgagctgtccaagaaccagaggagctgcattttg
acctgtaaccacgggaacgggggctgccagcactcgtgtgacgatgctgacaatgggcct
gtttgtggatgtcaccccaagtacatcatgcacgtggatggcaaaacctgcctggagagg
gaagaagctgctgttgaagtttctgagggaaacaccacagcagcagctgatgtggacaag
agagtgaagcgacggctgcttatggaaacgtgcgcggtgaataatggtggctgcgaccgc
acctgtaaggacacatccaccggagtccactgcagctgccccgttggattcacgctccag
tttgatggcaagacatgcaaagatattgatgaatgccaggccaataatggaggctgtgat
catttctgtaaaaacactgttggcagttttgattgcagctgcagaaaaggatttaaatta
ttaacagatgagaagtcctgtcaagacattgatgagtgctccttcgagcgggcgtgcgac
cacacgtgcatcaaccaccccggcaccttcgagtgcacatgtaacaagggatatgccctg
tatggcttcacacactgtggagatattaatgaatgtagcatcaacaacggtggttgccag
cagctgtgtgtgaacacaccgggagattatgagtgcctgtgtcactctaactacaagcta
cactggaataaaaaggactgtgttgagacaaaagatcccttgtctgataatgtgtcaccc
aaggtattgctgcactgcattaagagtggtgggagtgatagatgctttctgagctgctct
ccggatgtccaggtattctctggaacacaagatgcctacaccctcacctgtggcaggtcc
tctcagcttaagaaaaagcagcaaaatgcaaacgcttccagctggctggatgctccagcc
atcaagataagcataacctttaaattaaatgaaggaaaatgtagtttgaaaaagactgag
atgtttcaagaaggtctggaacagatgataccagagagacaaaattcagtaatggagagc
ttccactatgtaaacctaacatgcagctctggcaagaaagttcatggagccctcagtaga
ctgacagcgactagagagatttttatcactgcggactttgagcttgaaacgagccggaag
gaggtgacagacacgtgtgacgtgcgctgtgcccggaagaagacggaaaagcggttccgt
aaaaccatccgaaccttacggaagacggtcagcagggaccagttccgcatccgcgtctct
ggcacggaccacgaggtggccagaaaggctctcaagccaccggagccacagcagtcctgt
ggtgtgggacagcagcagccgggtaacagatgtgatcagtgctcccctggtgaatattct
cctgatggcttcaagccctgcctgccgtgtccccttggaacataccagcctgaggctggg
agagtgtcctgctttccctgtggaggaggtctaacaacaaggcacagcggagcatccttg
ttccaggactgcgagaccaaagttcagtgttctcctggccatttttacaacaccacaact
caccgatgcattcgctgtgcgactgggacataccagcctgagtttggacaaaattactgc
atttcctgccctggaaacaccactactgattttgatgggtcaacaaacataacacagtgc
aaaaacaggcagtgtggaggggaattgggagattacactggatatattgaatcacctaac
tatcctggggactaccctgcaaacaccgagtgcacttggaatatcaacccaccgcccaag
cgccgcatcctgatcgtggttccagaaatattcctgcccatagaagacgagtgtggagac
tacctggtgatgagaaaaagctcttcctccaactcggtgaccacatatgagacctgccag
acctacgagcgccccatagctttcacttccaggtctaagaaactgtggatccagttcaag
tcgaatgaagggaacagtgccaaaggattccaagttccttatgtaacctatgatgaggat
taccaagaactaatagaagacattgttcgggatggcagactttatgcatctgaaaatcat
caagaaatacttaaggacaagaagctgataaaagcattgtttgacgtgttggcgcatcca
cagaactacttcaagtacacagcccaagagtcaagagagatgttcccgagatccttcatt
cggctgctgcgctccaaagtttccagatttttgaggccttacaaatag

DBGET integrated database retrieval system