KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100590
Entry
102100590         CDS       T02921                                 

Gene name
CUL1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04110  Cell cycle
phi04114  Oocyte meiosis
phi04120  Ubiquitin mediated proteolysis
phi04141  Protein processing in endoplasmic reticulum
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
phi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102100590 (CUL1)
   04120 Ubiquitin mediated proteolysis
    102100590 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102100590 (CUL1)
   04340 Hedgehog signaling pathway
    102100590 (CUL1)
   04350 TGF-beta signaling pathway
    102100590 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102100590 (CUL1)
   04114 Oocyte meiosis
    102100590 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102100590 (CUL1)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     102100590 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 102100590
NCBI-ProteinID: XP_005519147
LinkDB
Position
Un
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcgaataggagtcagaacccgcatggacttaaacagattggtcttgaccagata
tgggatgacctaagagctggaattcaacaggtttacaccagacaaagtatggcgaaatcc
agatacatggaactctacactcacgtttataactactgtaccagtgtacaccagtctaat
caagcacggggagctggagtacctccttctaaatcgaaaaagggccagacacctggaggt
gctcagtttgttggcttggaattgtacaaacggctaaaagaatttctgaagaactacttg
acaaatctccttaaggatggtgaagatttgatggatgagagcgtgctgaaattctacact
caacagtgggaagattataggttttcaagcaaagtactgaatgggatatgtgcctacctc
aatcgacattgggttcgtcgtgagtgcgatgaaggtcgtaaaggaatatatgaaatttat
tcacttgccttggtgacctggagagactgcttattcaggccattaaataagcaggtaaca
aatgcagtgttgaaattgattgaaaaggaaagaaatggtgaaactatcaatacaaggctg
atcagtggagttgtacaatcctatgtggagctggggctgaatgaagatgatgcatttgca
aaaggacctacactaactgtctataaagaatccttcgaatctcagttccttgctgacaca
gagagattttatacacgagaaagtactgaattcttgcaacagaacccagttacagagtac
atgaagaaggccgaagctcgccttcttgaggaacagcgtagagttcaggtgtatctccat
gagagcacacaagatgagttagcacgaaagtgtgagcaagtacttatcgaaaaacacctg
gagatatttcatacagagtttcagaatttgttggatgctgacaaaaatgaagacttgggt
cgcatgtataaccttgtatctcgaattcaggatggccttggagagctgaaaaaacttttg
gaaacccacattcataatcagggtctagctgcaattgagaaatgtggagaagctgcacta
aatgatccaaaaatgtatgtacagacagtgttggatgtccataagaaatacaacgcttta
gtcatgtctgcgttcaacaatgatgctggcttcgtggctgcactagacaaagcttgtggt
cgatttataaataataatgcagtgacgaaaatggctcaatcatccagtaaatccccagag
ctactggcacgatactgtgactctttactaaagaaaagctcaaagaatccagaagaagca
gaattggaagatacactcaatcaagtgatggttgtcttcaagtacattgaggataaagat
gtgtttcaaaaattctacgctaaaatgctggcaaagagacttgtgcatcaaaacagtgct
agtgatgatgctgaggcaagcatgatctcgaaactaaaacaagcttgtggttttgagtat
acctccaagctgcagcggatgttccaagatattggtgtaagcaaggatttgaatgagcaa
tttaaaaagcacctgaccaattcagaaccattagatctggatttcagcatccaagtgttg
agttccggatcgtggccgttccagcagtcctgcacgtttgctcttccatctgagttagaa
cggagctatcagagatttactgcattttatgctagtcgtcacagtggaagaaaattaaca
tggttgtatcagctgtctaaaggggaattggttaccaactgtttcaaaaacagatacaca
ttacaggcatccacattccagatggcgattttactgcagtacaacacagaagatgcctac
accgtgcagcagctgacagacagtactcaaataaaaatggatatcttggcacaagttcta
cagatactgttaaaatcaaaattgcttgttttggaagatgaaaatgcaaatgttgatgaa
gtggagttaaaaccagatactttaataaaactgtatcttggttacaaaaataaaaaatta
agggtaaacatcaatgtgccaatgaagactgaacagaagcaggagcaagaaaccacacac
aaaaatatagaggaagataggaaactactgattcaggctgctattgtgagaatcatgaaa
atgaggaaagttctaaaacaccagcaactgcttggagaagtgctaacgcagctgtcctca
aggttcaagccacgagttcctgtaattaagaaatgcatcgacatcctcattgagaaggag
tacttggaacgtgtagatggtgagaaggacacctacagttacttggcttag

DBGET integrated database retrieval system