KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100643
Entry
102100643         CDS       T02921                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102100643 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phi04052]
    102100643 (EPO)
Cytokines and growth factors [BR:phi04052]
 Cytokines
  CSF and other factors
   102100643 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102100643
NCBI-ProteinID: XP_014117738
LinkDB
Position
Un
AA seq 175 aa
MGAAGLCVLLLLLLGVPGRPQPPPEGPPSLCDPRVIERFILEARDAERGAAGCGPHCDLP
EPIAVPDPGVNFNLWQSLDAGSRAQEVAAGQAALAAAVLRARELLRDPRVRPSLDRAYGT
ARSLARLLRGLPAPAPPLPSPPAPLRVRTLPRLLGVLSRFLRGKVRLFLADTCPR
NT seq 528 nt   +upstreamnt  +downstreamnt
atgggggcggcggggctgtgcgtgctgctgctgctgctgttgggggtcccggggcgcccc
cagcccccccccgagggccccccctcgctctgcgacccccgagtgatcgaacgcttcatc
ctggaggcccgcgacgccgagcggggggcggccgggtgtggcccccactgtgacctcccc
gagcccatcgctgtccccgaccccggcgtcaacttcaacctgtggcagagcctggacgcg
gggtcccgggcgcaggaggtggcggcgggacaggcggcgctggcggccgcggtgctgcgg
gcgcgggagctgctccgggacccccgagtgcgccccagcctggaccgcgcctacgggacc
gcgcggagcctggcgcggctgctgcgggggctgcccgcgccggctccgcccctgccctcg
ccccctgccccgctgcgggtccggaccctcccccggctcctgggggtcctgagccgcttc
ctgcgggggaaggtccggctcttcctggccgacacctgcccgcggtga

DBGET integrated database retrieval system