KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101455
Entry
102101455         CDS       T02921                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Ras_bdg_2 PHD Mst1_SARAH
Other DBs
NCBI-GeneID: 102101455
NCBI-ProteinID: XP_005522342
LinkDB
Position
Un
AA seq 342 aa
MELIELRDLQPEPRPGRGRLERANALRISPARRPGPGAHPDPRLTAAPGAGHRFEPRRRG
LHTWCDLCGDFVWGGGRKSLQCRHCSFTCHYRCRALVRLDCSGPPGAGDEDDGNEQVLEK
DTNVDEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPATKRVPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKFTVIDN
PRKFALFERSEKDEQVYLRKLGDDEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTL
PELHNFLLILQREEEEHVRRLRHRYARCRQKMQEALATRTPG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagctcatcgagctgcgggatctgcagcccgagccgcggccgggccggggccgcctg
gaacgagccaacgcgctgcgcatcagccctgcccgccggcccggccccggggcgcatcct
gacccgcggctgacggcggcaccgggcgccgggcaccgcttcgagccgcggcgccgtggg
ctgcacacctggtgcgatctctgcggggacttcgtctggggcggcggcaggaagagcctc
cagtgccgccactgcagcttcacctgccactaccggtgccgggccctggtgcggctggac
tgcagtggccccccaggtgctggtgacgaggacgatggcaacgagcaggtgttggagaag
gacaccaacgtggatgaacccagcgagtgggagaagacagagctggaccaggcgcaggtg
gagcagcggatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctgaac
aaggacggctcctacaccggcttcatcaaggtgcagctgaagctagttcgccctgtctca
gtgccggccaccaagcgggtcccctccctgcaggcggggcggccgcacccccagggggtg
aagcgccgcacgtccttctacctgcccaaggggaccgtcaagcacctgcacatcctttcg
cacacccgcgccagcgaggtcattgacgccctcctccgcaagttcactgtcatcgacaac
ccccgaaagttcgccctcttcgagaggtctgagaaggatgagcaagtgtacctgcggaag
ctgggtgacgacgagcagcccctgcggctgcggctgctggccggccctagcgagaaggtg
ctgagtttcatcctgaaggagaacgagaccggagaggtgaactgggacgccttcacgctg
ccggagctgcacaacttcctgctgatcctgcagcgggaggaggaggagcacgtgcggcgg
ctgcggcaccgctacgcgcgctgccgccagaagatgcaggaggcgctggccacgcgcacg
ccggggtga

DBGET integrated database retrieval system