KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101563Help
Entry
102101563         CDS       T02921                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102101563 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102101563 (SETDB1)
Enzymes [BR:phi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102101563 (SETDB1)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102101563 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102101563 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD SET DUF4537 YkyA XkdW
Motif
Other DBs
NCBI-GeneID: 102101563
NCBI-ProteinID: XP_014117472
LinkDB All DBs
Position
Un
AA seq 1407 aa AA seqDB search
MDSQDIKELQQEVMDELGISMEELQEIIDKEVENSEWVRQRKQQLEELEQCMRHKEEEVA
HVDQLIDDAMRAIDKCETLAKELYSMMGLQYRESSSEDEAPAATEVIEIPDEEDDDVMSV
DSGWKRSSSSPRISRDQSLLREAMVAMRKSARDVAKFMDAVNKKTNLQEAQKDAQPPQES
PGTAQPITVPAAPDNDLNTDGDLKVGMRILGKKRTKTWHKGTLIAIQTVGAGKKYKVKFD
NKGKSLLSGNHIAYDYHPSAERHHVGRRVVARYKDGNQMWLYAGIVAETPNVKNKNRFLI
FFDDGYASYVKEWELYPVCRPLKKAWEDIEDVSCRDFIEEYITAYPNRPMVLLKNGQLIK
TEWEGTWWKSRVEEVDGSLVKILFLEALPMGTVSVSFSFPQEDKRCEWIYRGSTRLEPMF
SMKTSTASTQEKKQSGQTRTRPNVGAVRSKGPVVQYTQDLAGAGPQYRAPEQPAAARPAS
PQPAEMECSDTQLAQGRKQVAKKSTSFRPGSVGSGHSSPSSPVLGDSPAAGRALPAPQHR
VPSSGPSQPFHGMTDRVPSEPSYRAPLEKLFYLPHVCSYSCLSRVRPIRSDQYRSRNPLL
IPLLYDFRRMTARRRVNRKMGFHVLYKTPCGLCLRSMHEIERYLFETDCDFLFLEMFCLD
PYVLVDRKFQPYKPYYYIADITKGKEDVPLSCVNEIDNTPPPQVAYSKERIPGKGVYINT
SWEFLVGCDCKDGCRDKSRCACHQLTIQASGCTPGGQINPNSGYQHKRLEECLPTGVYEC
NKRCKCNVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDF
ADKEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDNSGVDLKDDDDDENTGSEELEE
SNEDSSDDNFCKDENFSTSSVLRSYATRRQTRGQRDHGLSETASKDSGLARPLGHDEPAT
APPCKLPVSEETSKNKVASWLSSNSMAESFQDSDSASSLRMGEGGEAKAVKMEISVEREK
GCAPTPGELNGEAKAAKKEEPEESTKIPGLSSLGRRYGYNPCPPKLEGIRRPVSGTLLLQ
SRRRSLALPTPSEHRQRRGAQGRAGPGHRQRQRRHPDHFLRIRGGGRGGQEKPIIWVRSC
EETGGCEIHPRLRPQVHPRHRHQIHAAGGGRQGRERGARAPQHAAVLRRGGELLHHRRQA
RGQPGPLPQPQLHPKPLRAERLRGHPRPSLPLGRLLRQQADPSRHGADLGLQLRGRQRGG
QGAAVLLRGHRLPGPAALSPLLPADPAPPEACCSLSLSEGKVPSQEVLSSATHLENHRWT
WSRNGLGLCWAAIPSPWASPTLGSLEEGAFPALLQFSTKFKAQSNFFQQQALVQCSQQVL
SNWHRGLESRREGGGKNPWKNWTNWDL
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaggacatcaaagagctgcagcaggaggtgatggacgagctgggaatctcc
atggaggagctgcaggaaatcatcgacaaagaagtggagaattccgagtgggtgaggcag
cggaaacagcagctggaggagctggagcagtgcatgaggcacaaggaggaggaggtggcc
cacgttgaccagctcattgacgatgccatgagggccatcgacaagtgtgagacactggca
aaggagctgtattccatgatgggcctgcagtaccgggagagcagctcggaggacgaggct
ccggcagccacggaagtgatcgagatccccgacgaggaggacgacgacgtcatgagcgtg
gactcgggctggaagcgcagcagcagcagtcccagaatctccagggatcagagtctgctg
cgggaagcaatggttgccatgaggaaatctgcccgggatgttgcgaaattcatggatgct
gtaaacaagaaaacaaacttgcaggaagcacagaaagatgcacagcctcctcaggaatct
cctggcactgcccagcccatcactgtccctgcagcccctgacaatgatctcaacactgat
ggggacctcaaagtgggcatgaggattttggggaaaaagagaaccaagacttggcacaag
gggacgttgattgccatccagacggtcggtgctggcaagaaatataaagtgaaatttgat
aataaagggaagagtttgctgtcgggcaaccacattgcctacgattaccacccgtctgcc
gagaggcaccacgtgggcaggagggtggtggccaggtacaaggatggcaaccagatgtgg
ctctatgctgggatcgtggctgagacccccaacgtcaagaataaaaacaggttcctgatc
ttctttgacgatggctacgcgtcgtacgtgaaggagtgggagctgtacccggtctgccgg
ccactgaaaaaagcctgggaggacattgaggatgtttcctgtcgggatttcattgaggag
tacatcactgcctaccccaaccggcccatggtactgctgaagaatgggcagctgatcaaa
actgagtgggaaggaacctggtggaaatccagagtggaagaagtggatggaagtctggtg
aaaatccttttcctggaagctcttcccatgggaactgtgagcgtttccttctccttcccg
caggaggacaaacgttgtgagtggatttaccgaggttccacacgcctcgagcccatgttc
agcatgaaaacttccacagcttccacccaggaaaagaagcaaagtgggcaaaccaggact
cgtcccaatgttggtgctgtgaggagcaagggccctgtggtccagtacacccaggattta
gcaggagccggtccccagtacagggctccggagcagccggcggctgcacgtcccgcgtct
cctcagcctgcagagatggaatgctccgacacccagctggcccagggcagaaagcaggtg
gccaagaaaagcacttccttccgtcctggctccgtgggctctgggcactcatccccatcc
tcccccgtcctcggggacagcccggcagccgggagggccctcccggccccgcagcaccgc
gtccccagcagcggcccctcccagcccttccacggcatgacggaccgcgttcccagcgag
ccgtcctaccgggccccgctggagaagctcttctacctgccccacgtgtgcagctacagc
tgcctgtcgcgggtgcggcccatccgcagcgaccagtaccgcagccgcaacccgctgctc
atcccgctgctctacgacttccgccgcatgacggcgcggcgccgcgtcaaccgcaagatg
ggcttccacgtgctgtacaaaacgccctgcgggctctgcctgcgctccatgcacgagatc
gagcgctacctcttcgagacggactgcgacttcctgttcctggagatgttctgcctggat
ccctacgtgctggtggatcgcaagttccagccctacaagccctactactacatcgccgac
atcaccaagggcaaggaggacgtgcccctgtcctgcgtcaacgagatcgacaacacgccg
ccgccgcaggtggcctacagcaaggagaggatccccgggaaaggggtctacatcaacacc
agctgggaattcctcgtgggctgtgactgcaaggacggctgcagagacaaatccaggtgt
gcctgtcaccagctgaccatccaggccagcggctgcacccccggagggcaaatcaacccc
aactcgggctaccagcacaagcggctggaggagtgtctcccgacaggcgtttacgagtgc
aacaagaggtgcaagtgcaacgtgaacatgtgcaccaaccgcctggtccagcacggcctc
caggtgcggctgcagctcttcaagacccagaacaaaggctggggcattcgctgcctcgac
gacatcgccaagggctcctttgtctgcatctacgcagggaaaatcctcacagacgacttt
gctgacaaagaggggctggagatgggtgacgagtactttgccaacctggaccacattgag
agcgtggagaacttcaaggagggctacgagagcgacgccaagtgctcctcggacaacagc
ggcgtggacctcaaggacgacgacgacgacgagaacacgggctcggaggagctggaggaa
tccaacgaggacagctccgacgacaacttctgcaaggacgagaacttcagcacgagctcg
gtgctgcgcagctacgccacgcgccggcagacgcgcggccagcgcgaccacggcctctcg
gagacggcctccaaggactcggggctcgcccggcccctcggccacgacgagcccgccacg
gcccccccctgcaagctgcccgtgtctgaggagacctcgaagaacaaggtggcctcgtgg
ctgagctccaacagcatggccgagagcttccaggacagcgacagcgcctcgtccctgagg
atgggcgaagggggagaagccaaggccgtgaaaatggagatctctgtggagagggagaag
ggctgtgctcccacgccgggagagctgaacggagaggcgaaggcagccaagaaggaggaa
cctgaagaatcaaccaaaattcctgggctgagcagcctgggcaggaggtacggctacaac
ccctgtccccccaagctggaggggatccgcaggccggtgagcgggacgctgctgctgcag
agccgccggcgatccctggccctgccaaccccgtcagagcaccgacagcgaaggggagca
cagggcagggcaggccccgggcaccgccaacgacagcgacgacatccagaccatttcctc
aggatccgaggaggaggaaggggaggacaagaaaaacccatcatctgggtcaggtcctgt
gaagagacaggtggctgtgaaatccacccgaggcttcgccctcaagtccacccacggcat
cgccatcaaatccacgccgctggcggcggccgacaagggcgagagcgcggggcccgtgcg
ccgcagcacgcggcagttctacgacggggaggagaactgctacatcatcgacgccaagct
cgagggcaacctgggccgctacctcaaccacagctgcaccccaaacctcttcgtgcagaa
cgtcttcgtggacacccacgaccttcgcttcccctgggtcgccttcttcgccagcaagcg
gatccgagccggcacggagctgacctgggattacaactacgaggtcggcagcgtggaggg
caaggagctgctgtgctgctgcggggccatcgactgccggggccggctgctctgagcccg
ctgctcccagcggatcccgctcctccagaggcctgctgctcgctttccctcagcgagggt
aaagttccttctcaagaggttctcagttctgccactcacctggaaaatcacagatggaca
tggagcaggaacggactcgggctgtgctgggcggcgattcccagcccctgggcttctccc
accttgggctccctcgaggaaggagcttttcctgctctgctccagttttccaccaaattt
aaggcacaaagtaattttttccagcagcaagcacttgtccagtgttcccagcaagtgctt
tctaattggcacagaggccttgaaagtaggagggagggtggtggaaagaatccctggaag
aactggaccaattgggatttatag

DBGET integrated database retrieval system