KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101586
Entry
102101586         CDS       T02921                                 

Gene name
BTRC
Definition
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04114  Oocyte meiosis
phi04120  Ubiquitin mediated proteolysis
phi04218  Cellular senescence
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102101586 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102101586 (BTRC)
   04340 Hedgehog signaling pathway
    102101586 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102101586 (BTRC)
   04218 Cellular senescence
    102101586 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102101586 (BTRC)
   03036 Chromosome and associated proteins [BR:phi03036]
    102101586 (BTRC)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     102101586 (BTRC)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     102101586 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like F-box ANAPC4_WD40 WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 102101586
NCBI-ProteinID: XP_014105993
LinkDB
Position
Un
AA seq 624 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALPAFQNSSEREDC
NNDEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLGSTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLSERRGWGQYLFKNKPPDGTAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRCPCKSLSRRNENLSQGQSRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSK
DRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRT
LNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVS
GAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
FLNDPAAQAESTRSPSRTYTYISR
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggacccggccgaggccgtcctgcaggagaaggcgctcaagttcatgtgctctatgccc
agatctctgtggctgggctgctccagcctggcggacagcatgccctcgctgcgatgcctg
tataacccagggactggcgcactcccagctttccagaattcctctgagagagaagactgt
aataatgatgagccccctaggaagatcattcctgagaagaattcacttagacagacctac
aacagctgtgccagactgtgcttaaaccaggaaacagtatgtctaggaagcactgctatg
aagactgaaaactgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaaagaaaactgtctgcaagctatgagaaggagaaggagctctgcgtcaagtac
tttgaacagtggtccgagtctgatcaggtggagtttgtggagcacctcatctcccagatg
tgtcactaccagcacggacacataaactcatacctcaaacccatgttacagcgggacttc
atcactgcactgccagctcggggattggatcacattgctgagaacattctgtcatacctg
gatgccaaatctttgtgtgctgctgagctggtgtgcaaggagtggtaccgggtgacatct
gacgggatgctatggaagaagctcattgagagaatggtcagaacagattccctgtggagg
ggtttgtcagagaggagaggatgggggcaatatctatttaaaaataaacctcctgatgga
actgcaccacccaactccttctacagagcactttaccccaaaattatacaagacatagag
acaatagagtcgaattggcggtgtggaaggcacagtttacagaggatccactgccgaagt
gagacaagcaaaggggtttattgtttacagtatgatgatcagaagatagtaagcggccta
agagacaatactattaagatctgggataagaatacattggaatgcaagcgaattctcacg
ggacacacaggttctgtcctgtgcctccagtatgatgaacgggtgatcattactggatct
tcagactcaacagtcagatgtccatgcaaatcgctgtcaaggagaaatgagaatctaagc
caaggccagtcaagagtgtgggatgtgaatgcaggtgagatgctgaatacactgatccac
cactgtgaagccgtgctgcacctccgcttcaacaacggcatgatggtgacgtgttccaag
gaccgctccatcgccgtgtgggacatggcctccccaacagacatcaccctgaggagggtg
ctcgtggggcaccgagctgccgtcaacgtagtggactttgatgacaagtacattgtatcg
gcatcaggtgacagaactataaaggtatggaacactagtacctgcgaattcgtgcgcacc
ttaaatggccacaaacgaggcattgcatgtctgcagtacagagacaggctagtagtgagc
ggctcttcagataataccatcaggctgtgggatatcgagtgtggggcatgtttacgagta
ctggaaggccatgaagagttggtgagatgcatacgctttgataacaagaggatagtcagt
ggggcatatgatgggaaaatcaaagtgtgggatcttgtggctgctttggatccccgtgct
ccagcagggaccctctgcttgcgaacccttgtggagcattctggaagagtctttcgactt
cagtttgatgagttccagatcgtcagcagctcacatgatgacaccatcctcatctgggat
tttctgaatgatccagctgcccaggcagaatccactcgctccccgtccagaacatacacc
tacatctccagataa

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103643
Entry
102103643         CDS       T02921                                 

Gene name
FBXW11
Definition
(RefSeq) F-box and WD repeat domain containing 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04114  Oocyte meiosis
phi04120  Ubiquitin mediated proteolysis
phi04218  Cellular senescence
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102103643 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102103643 (FBXW11)
   04340 Hedgehog signaling pathway
    102103643 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102103643 (FBXW11)
   04218 Cellular senescence
    102103643 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102103643 (FBXW11)
   03036 Chromosome and associated proteins [BR:phi03036]
    102103643 (FBXW11)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     102103643 (FBXW11)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     102103643 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 102103643
NCBI-ProteinID: XP_005532620
LinkDB
Position
Un
AA seq 531 aa
MCALRCLQSMPSVRCLQNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYEK
EKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHI
AENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYL
FKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDE
KIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGE
VLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDF
DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIE
CGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEH
SGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgcgcactgagatgcctgcagagcatgcccagtgtcagatgtctccagaacacgtca
gtaatggaggatcagaatgaagacgagtctccaaagaaaaataccctgtggcagataagt
aatggaacttcatctgtgattgtctcaagaaaaagaccatcggaaggaaactacgaaaag
gaaaaagacttgtgtataaaatattttgaccagtggtctgaatcagatcaagtggaattt
gtggaacacctcatttcccgaatgtgtcactatcagcatggacatattaactcttacctg
aagcccatgttacaacgggacttcatcactgcgctgccagagcaaggcttagatcacata
gcagaaaacatcctttcctatctcgatgccagatccctatgtgcagcagagctggtgtgt
aaggagtggcagagagtcatctcggaggggatgctgtggaagaagctcattgagaggatg
gtacgcacagacccgctctggaaggggctctcggagaggaggggttgggatcagtacctg
tttaaaaacagaccaacagatgggccccccaattcgttttacaggtccttatacccaaag
ataatccaggatatagagactatagaatccaactggaggtgtgggaggcacaacttgcaa
aggatccagtgccgctctgagaacagcaagggggtctactgtttacagtatgatgatgag
aagatcatcagtggcctacgagataactccattaagatttgggacaaaacaagcttggaa
tgtttgaaagtattaacgggacatactggctcagttctttgtctgcaatatgatgaaaga
gttattgtaactggatcttcagattctacagtgagagtctgggatgtaaataccggtgag
gttctgaacacgctcatccaccacaacgaggccgtgctccatctgaggttcagcaatggg
ctgatggtgacgtgctccaaggacaggtccatcgccgtgtgggacatggcctcccccacg
gacatcaccctgcgccgcgtcctggtgggacaccgcgccgccgtcaacgtggtggacttc
gacgacaagtacatcgtgtctgcctcgggggacaggaccatcaaggtgtggagcaccagc
acgtgtgaatttgtgcggaccctgaacgggcacaagcgcggcatcgcctgcctgcagtac
cgggaccgcctggtggtcagtggctcctcggacaacaccatcaggctctgggacattgaa
tgtggtgcctgtttaagagtattagaaggccatgaagagctggttcggtgcatcaggttc
gacaacaagaggattgttagtggagcctatgatgggaaaattaaagtttgggacttgcaa
gctgctcttgaccctcgtgccccagcaagtacgttatgcttgcgtacgttagtggaacat
tcaggacgtgtctttaggctccagtttgatgaatttcagatcattagtagttcccatgac
gatacaattctgatttgggatttcttaaatgtgccaccgagtgcccagaacgagacccgc
tctccatctagaacatacacctacatctccagataa

DBGET integrated database retrieval system