KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101960Help
Entry
102101960         CDS       T02921                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi01100  Metabolic pathways
phi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102101960
   00500 Starch and sucrose metabolism
    102101960
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102101960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102101960
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102101960
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102101960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102101960
NCBI-ProteinID: XP_005523051
LinkDB All DBs
Position
Un
AA seq 941 aa AA seqDB search
MEPFSEPLHGAGTRTMKSYQKLTTTQPAACRVEEEGAAAVPSGHGKLAPWWVGSGLLVAA
VLLSTITVWVLRQVSGGWLGPTPPPKCLLVPESHRFDCYPERRVVVTQELCESRGCCFIQ
SPPPAQGKQGVPWCFYPPDFPSYTLESLNQTALGMVGLLVRREKAYYPQDIEKLRLDVEF
ETDTRLHIKITDAANPRYEVPFDVPRVMKRAENPIYSLNFSWDPFGVLLQRKATGTVLLN
TTVAPLIFADQFLQISTSLPSKFLYGLGEHRGSLVHSVEWNTLTLWARDVSPTESFNLYG
AHPFYLLMEEGGNTHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPSMVIQQ
YQQVIGFPAMPPIWALGFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRD
FTLDSQKFASLPSLVEDLHKHGQHYVMILDPGISSTSPHGSYWPYDEGLRRGLFLNTTQG
QPLIGQVWPGFTAFADFSNPDTHQWWLENLQHFYAHVPFDGLWIDMNEPSNFMDGSEDGC
PPGEFDSPPYTPAVLGDSLSAKTVCASAKQKVSVHYNLHNLYGLMEAKATASALIKIRGK
RPFVISRSTFPSQARYSGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGST
SEELCTRWMQLGAFYPFARNHNTQNEKAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLF
HRAHLQGDTVARPLFFEFPWDVATWELDRQFLWGRSLLVTPVLEPGVDSVTGYVPQGTWY
DFYTGSSVNSSGEMLKMSAPLEHLNLHIREGSILPTQKPGTTTEVTRGNPLRLIVALSSH
ATAWGDLFWDDGESLDTFEKGNYSYVVFNVTQNVFTSTVLHASTEATKVTIDTLSIFGVQ
KPPSKVLLNGQEKTFSYLDNQVLTVSDLGMSLSQGFSLQWL
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggagccgttttctgagcctttgcacggagcaggcaccaggacaatgaagtcgtaccag
aagctgacaacaacacagccagcagcatgccgggtggaagaagaaggggctgctgcggtg
ccctccggccatgggaagctggccccatggtgggtgggcagtgggctgctggtggctgct
gtcctgctgagtaccatcactgtctgggtgctgcggcaagtatcggggggctggctcgga
cccacaccaccccccaaatgtctcctggtacctgagagccatcgctttgactgctaccca
gagcggcgagtggtggtgacacaggagctctgtgaaagccgaggctgctgcttcatccag
agtcccccaccggcacagggcaagcagggggtgccctggtgcttctatccccctgacttc
cccagctacaccctggagagcctcaaccagacagcactgggcatggtggggttgctggtg
cgaagggagaaggcctattaccctcaggacatcgagaagctgaggctggatgtggaattt
gagacagacacacggctgcacatcaagataacagatgcagccaacccacgctatgaggtt
ccctttgatgttccccgggtgatgaagagggcagagaaccccatctacagtctgaacttc
tcctgggacccctttggggtgctgctgcaacgcaaagcaacagggacggtgcttctaaac
accactgtggcccccttgatctttgctgaccagtttctccagatatccacatcactccca
tccaagttcctctacgggctgggagagcaccgtggcagcctcgtgcacagcgtggagtgg
aacaccctcacactgtgggcccgtgacgtctctcccacggaatcgttcaacctgtatggc
gcccaccccttctacctgctgatggaggagggtggaaatactcacggtgttttccttctc
aacagcaatgccatggaggtggctctgcagcctgctccaggcctgacctggaggaccatt
ggaggggtgctggatttttacatcttcctggggcctgatcccagcatggtcatccagcag
taccagcaggtgataggtttcccagccatgccgcccatctgggctcttggcttccacctc
tgccgctggggctacggatccagcaatgagacgtggcagactgtgagagccatgaggaac
taccagatcccccaggatgcacagtggaatgacattgattacatggatgggtaccgggac
ttcaccttggattcccagaagtttgcttccctcccctccctggtggaagacttacacaaa
cacgggcagcactacgttatgatcttggatcctggcatcagcagcaccagccctcatggc
tcctactggccttatgatgaaggtttgagacggggcttgttcctcaacaccacacaaggg
cagccactcatcggacaggtctggcctggtttcactgccttcgcagacttctccaaccca
gacacacaccagtggtggctggagaacctgcagcacttctatgcccacgtgccctttgac
ggcctctggatcgacatgaatgagccatccaacttcatggatgggtctgaagatggctgc
cccccaggagagttcgacagcccaccctacactccagctgtgctgggcgattccctctct
gcaaagacggtgtgtgcctcggcaaagcagaaagtctcggtgcactacaacctccacaac
ctctatgggctgatggaagccaaagccacagcaagcgccttgatcaagatccgggggaag
cgtcccttcgtcatctcccgctccaccttccccagccaggcccggtactcggggcactgg
ctgggtgacaaccggagccagtggaaggacatgtattactcaattccagggctgctgagc
ttcagcctctttggcatcccactggtcggggcagacatctgcggcttctctggcagcacc
tcggaggagctgtgcacccgctggatgcagctcggtgccttctacccctttgctcgcaac
cacaacacccagaacgagaaggcccaggacccaacagcgttcagccccgcagccaggaca
gccatgaaggacgtgctgctgacccgctattccctcctgcccttcctctacacccttttc
caccgtgcccacctgcaaggggacactgtcgcccggcccttgttctttgagttcccttgg
gatgtggccacatgggagctggacaggcagttcctgtggggccggagcctgctggtaaca
ccagtgctggagcccggggtggactcagtcacaggttacgtcccccaaggcacgtggtat
gacttctacacgggctcctcggtgaacagcagtggggagatgttgaagatgtcggcccct
ctggagcacctcaacctgcacatccgggaaggttccatcctgcccacccagaaaccagga
accaccacagaggtgacccgagggaaccccctgcgtctcatcgtggccttgtcctcgcat
gccactgcctggggtgaccttttctgggatgatggcgagagcctggacaccttcgagaag
ggcaactactcctacgtggtgttcaatgtcacacagaacgtcttcacctccaccgtcctc
catgctagcactgaggccaccaaggtcaccattgacacgctgagcatctttggagtgcag
aagccgcccagcaaggtcctcctgaatggccaggagaagaccttttcttacctggacaac
caggttctcacagtgagtgaccttggcatgagcctcagccagggcttctccctgcagtgg
ctgtga

DBGET integrated database retrieval system